Identifiers and Description

Gene Model Identifier

TTHERM_00402180

Standard Name

CTH16 (cathepsin 16)

Aliases

PreTt12762 | 43.m00280 | 3713.m00106

Description

Eukaryotic aspartyl protease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00026 ) Eukaryotic aspartyl protease
  • ( PF02207 ) putative zinc finger in N-recognin

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00402180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19123.19.997093137033517e-262eukaryotic aspartyl protease (
1258 aa)
OxytrichaContig18091.0.g120.000000100009565553302Putative zinc finger in N-reco
gnin (UBR box)
DictyBaseDDB_G02921280.0000020007268868677913DDB_G0292128 on chromosome: 6
position 1233335 to 1239538
WormBaseWBGene000163260.00008003872323201264locus:ubr-1 E3 ubiquitin-pro
tein ligase ubr-1 status:Par
tially_confirmed UniProt:P91
133 protein_id:CCD66417.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00402180(coding)
ATGAATAAAACTTAGAAAGTAGTGCTGTACTCTTTGGGAGGATTAGCTGCTTTAGCTGGA
ACATATTACTATTTTAGATAGCGCAAATTAAATTCATCTTCATATAATTATTTGCTAAAC
TAGTTCAAGAGAGATTTTTTCAAGATAGACATATTGAAACTTGCAAACATGCAATTTAAA
TTTGAGCAGCTATTTATAAAAGCAACAATGGATGAAAGTGGTTAAACTATTATTGAAAGA
CTGCAATATAAAGGTAATAAGAGTGAAGAAGAAATGCTAAAAATAGATTGTTGTAGTTAG
CATCTTAAAAGTGGAGCTGCTTATTATGAATGTCTTGATTGCTCCATAGTGAGATAAGAA
ATAGCCAAATCTAATAAAAAAAGCGAAGAATAGTGTATTTACTTAACTGTTTGTGAGGAC
TGTTTCGATATTTAAAAGCACAAGGGGCACAATTACACCAGACATCAAGCCTCAAATGAA
GAAATATTTAGATGCTGTTGTGGTGATTCGGCTTTTATGAAGAAAGAGAGCTTTTGTAAT
AAGCATTTGGGATATTAGGATCTTGTAAAAGTTTTTGATGAAGAAGAGAAAAAAGATCCA
AGGTTGTGGCAATAAATCGAAAGTTTCTTTCAAGATTTTTTCCATATTGCATTTGATACT
GCTAGTATTTTACTGTATAACACGGTAATGGGGTAATAAAATAAGACAAAGTCAATATAA
GCTCACCTTAATACATTTTTAGGATTTATTTTTGATAAAATAAATGAAATCATAGAATTA
AACAAGTGTTCTATGGTATTCTTTACTCGCTTATTTTAAAAGACTTTAAGTAAGCCTATT
GCCTTATAATTAGAAAGGAAACAAATGAGTACAGAATTTTATCGTTGGAGATTAACTATC
TTAAAATAGAGCTAGTTGAATACTGATCTTTCAATCTTAGACTATATTATGGTATTTTCT
AAATTGACTGACTCAAAAATCGATCAAAATATTGCTAACCTGCTAAGAAACTTGATAAAG
GTCGAAGAATATTTTCGTTGCTATTTTTCTGAGAGATTTTTCAAGTTTATTTTCTTTACT
TTCAAATCAGAAAAAATTTTCATTTAATAACTTAACAAGGAAGTGTTTAAAGCTATTTTA
CCACCTTTAGCTCACATGATGATAGAATAAGTTTCTTTAATGAGTGTATTCATTCATTTA
GTAGAGAAATTAGGTGAAGAAATATTTACACCTCTTGACCTATTCAATGAATATTTAGAA
ACAAAGCCTCCTCAAGTATTGGAAAACGATGAGGTCATATATCTTCTTTTTAATATTTGC
TTTGAAATGCTTAAGTAAATAAACATGCTTAAAATCATACTTCCTAAATTTTACAAGCTA
ATCATAGACAAATATTTTATTATTTCTTATCGCATGTTTATTAGAAATTCAATCTCATTC
AAAAAAGAACCAAACAAAAGTGATTTTTTCATTTCAAATATCGATCAAGTTTGTGAGTCC
ATTCACATGCAAATCTTAGAACCATAGGTCCTTCTTTGCTTCATCAATATTTATGAAGGC
ATTCTTTTGATGGAGGATGAAAACTTAGTTAAAGAGATTATTCCATATATCTGCTAAGCT
TTTAGTAAAATAACCTTAACAGCTTATTTAAAACTTAATGAATTGTATGAGAAAGATATT
TGCTTCATCAGTTTATCTCTATCTTTTGTTATTCAATTACCTCTTTTGATCGCTCTTTCT
GAACGCAAGATGTTTTCCAAAAGCGTGGTTTAAGATTTCTTTGAAAAAAATTTTAAATAT
TCAATTAGAGTTGAGGAAACTGACAGTTAGTAAGAAGCAGAAAAAAAAAGAAAAGAAAAT
AAAGAAGTTTTGATCACTTCAATATTAGCAATATTAAATAGCTTTATAACAATTAACACA
CAAACTTCTTTCTTTTAAGAGATGAAGATTGCACAAAGAAAACTAAACTTAAACTCATAT
GATGGATAAAGATTAAATAGTATTATTGCTTACACTATTGATTATATCATATCTCCATAA
TACAGAATATATGATTTCTTTACACTCTCTTATTAACTCATTTCACTTGCTGTAAAAGAT
GAAATTCTACATTCAAATGTCATGCTTTATCACAAACATATTGCTTTCTTTAAAGCTACC
AAGTAATCACCTTAGTTAATTTTCTTATCTGCAGATGCATAATAGAATACTACCTAAATG
TTTATAGATTCTACTCCCTTTATCAATGTCTTTTTTAATAACTTAGAATTATTCTTCCCT
GAATTTAGATAAAAGGATCTTCAAAATATAAAAGATAAAAAAGAAGCTAATAATGAAATA
GATTAAGCAGATAAGTAAGAAGAAAAAGAGAATAAAGAAGATATTAAGATAAAGGAAATA
AATATATTTGATAAAGTAAATGACTTTGAGGTATACAAACAAAATATGCACTAAATTATT
ATCACTATAATTTAAGCAAGAGAAAGGGAGAAAATGTTCATAAAAGACATTGAATTATTC
TGCAAAAGTTGTCTTCACTACCCATCAAATCTCTTGAAATATGCTTAAGAAGTTTGTAAA
ACAAAGGATAATGAAAAGCTTACTGAAAGTGATGACATCATTCTCCTGCAATAATACGAA
ACATAATATTTCCCTAAAAACTTTTTAAGAGTTTATGAGGATATTTACAAAGCAATATAA
GTTTTGTAAAGCAAAAATGAATTGACTATATACCCATATATTGGAACAAATAACGATTTA
CAGGGATTTTTCTAATATCAAATAGATTTAATTGAAAGAATTTTGATGAACCCAAATTAT
TAACAAAAATTGATTGAATAAATTACTTAAGACTCCTAATATCATCACATTTCATTCTTT
TTCTCAATTGTGATTTACTTTACATTGAAATTCCTTAAGTCATACAAAAATTCAGAAAAT
TTAAATGAAGAAACATCAAACAATTATAAAGAAATTTTAGAGATGTACAAAAATGAAGAG
ACAATTAAAGGTCTGAAAAAGTAAATTGAAGAAGAGCTAAATTTATCAAAGAAGAGACTT
ACTGATACAAGTGAAAAATAAATCTTAAAAGCATTTTTAGATATGTTAGACTACATCAAC
GATGTTTAAAAAATAGAATGA


>TTHERM_00402180(protein)
MNKTQKVVLYSLGGLAALAGTYYYFRQRKLNSSSYNYLLNQFKRDFFKIDILKLANMQFK
FEQLFIKATMDESGQTIIERLQYKGNKSEEEMLKIDCCSQHLKSGAAYYECLDCSIVRQE
IAKSNKKSEEQCIYLTVCEDCFDIQKHKGHNYTRHQASNEEIFRCCCGDSAFMKKESFCN
KHLGYQDLVKVFDEEEKKDPRLWQQIESFFQDFFHIAFDTASILLYNTVMGQQNKTKSIQ
AHLNTFLGFIFDKINEIIELNKCSMVFFTRLFQKTLSKPIALQLERKQMSTEFYRWRLTI
LKQSQLNTDLSILDYIMVFSKLTDSKIDQNIANLLRNLIKVEEYFRCYFSERFFKFIFFT
FKSEKIFIQQLNKEVFKAILPPLAHMMIEQVSLMSVFIHLVEKLGEEIFTPLDLFNEYLE
TKPPQVLENDEVIYLLFNICFEMLKQINMLKIILPKFYKLIIDKYFIISYRMFIRNSISF
KKEPNKSDFFISNIDQVCESIHMQILEPQVLLCFINIYEGILLMEDENLVKEIIPYICQA
FSKITLTAYLKLNELYEKDICFISLSLSFVIQLPLLIALSERKMFSKSVVQDFFEKNFKY
SIRVEETDSQQEAEKKRKENKEVLITSILAILNSFITINTQTSFFQEMKIAQRKLNLNSY
DGQRLNSIIAYTIDYIISPQYRIYDFFTLSYQLISLAVKDEILHSNVMLYHKHIAFFKAT
KQSPQLIFLSADAQQNTTQMFIDSTPFINVFFNNLELFFPEFRQKDLQNIKDKKEANNEI
DQADKQEEKENKEDIKIKEINIFDKVNDFEVYKQNMHQIIITIIQAREREKMFIKDIELF
CKSCLHYPSNLLKYAQEVCKTKDNEKLTESDDIILLQQYETQYFPKNFLRVYEDIYKAIQ
VLQSKNELTIYPYIGTNNDLQGFFQYQIDLIERILMNPNYQQKLIEQITQDSQYHHISFF
FSIVIYFTLKFLKSYKNSENLNEETSNNYKEILEMYKNEETIKGLKKQIEEELNLSKKRL
TDTSEKQILKAFLDMLDYINDVQKIE


>TTHERM_00402180(gene)
ATGAATAAAACTTAGAAAGTAGTGCTGTACTCTTTGGGAGGATTAGCTGCTTTAGCTGGA
ACATATTACTATTTTAGATAGCGCAAATTAAATTCATCTTCATATAATTATTTGCTAAAC
TAGTTCAAGAGAGATTTTTTCAAGATAGACATATTGAAACTTGCAAACATGCAATTTAAA
TTTGAGCAGCTATTTATAAAAGCAACAATGGATGAAAGTGGTTAAACTATTATTGAAAGA
CTGCAATATAAAGGTAATAAGAGTGAAGAAGAAATGCTAAAAATAGATTGTTGTAGTTAG
CATCTTAAAAGTGGAGCTGCTTATTATGAATGTCTTGATTGCTCCATAGTGAGATAAGAA
ATAGCCAAATCTAATAAAAAAAGCGAAGAATAGTGTATTTACTTAACTGTTTGTGAGGAC
TGTTTCGATATTTAAAAGCACAAGGGGCACAATTACACCAGACATCAAGCCTCAAATGAA
GAAATATTTAGATGCTGTTGTGGTGATTCGGCTTTTATGAAGAAAGAGAGCTTTTGTAAT
AAGCATTTGGGATATTAGGATCTTGTAAAAGTTTTTGATGAAGAAGAGAAAAAAGATCCA
AGGTTGTGGCAATAAATCGAAAGTTTCTTTCAAGATTTTTTCCATATTGCATTTGATACT
GCTAGTATTTTACTGTATAACACGGTAATGGGGTAATAAAATAAGACAAAGTCAATATAA
GCTCACCTTAATACATTTTTAGGATTTATTTTTGATAAAATAAATGAAATCATAGAATTA
AACAAGTGTTCTATGGTATTCTTTACTCGCTTATTTTAAAAGACTTTAAGTAAGCCTATT
GCCTTATAATTAGAAAGGAAACAAATGAGTACAGAATTTTATCGTTGGAGATTAACTATC
TTAAAATAGAGCTAGTTGAATACTGATCTTTCAATCTTAGACTATATTATGGTATTTTCT
AAATTGACTGACTCAAAAATCGATCAAAATATTGCTAACCTGCTAAGAAACTTGATAAAG
GTCGAAGAATATTTTCGTTGCTATTTTTCTGAGAGATTTTTCAAGTTTATTTTCTTTACT
TTCAAATCAGAAAAAATTTTCATTTAATAACTTAACAAGGAAGTGTTTAAAGCTATTTTA
CCACCTTTAGCTCACATGATGATAGAATAAGTTTCTTTAATGAGTGTATTCATTCATTTA
GTAGAGAAATTAGGTGAAGAAATATTTACACCTCTTGACCTATTCAATGAATATTTAGAA
ACAAAGCCTCCTCAAGTATTGGAAAACGATGAGGTCATATATCTTCTTTTTAATATTTGC
TTTGAAATGCTTAAGTAAATAAACATGCTTAAAATCATACTTCCTAAATTTTACAAGCTA
ATCATAGACAAATATTTTATTATTTCTTATCGCATGTTTATTAGAAATTCAATCTCATTC
AAAAAAGAACCAAACAAAAGTGATTTTTTCATTTCAAATATCGATCAAGTTTGTGAGTCC
ATTCACATGCAAATCTTAGAACCATAGGTCCTTCTTTGCTTCATCAATATTTATGAAGGC
ATTCTTTTGATGGAGGATGAAAACTTAGTTAAAGAGATTATTCCATATATCTGCTAAGCT
TTTAGTAAAATAACCTTAACAGCTTATTTAAAACTTAATGAATTGTATGAGAAAGATATT
TGCTTCATCAGTTTATCTCTATCTTTTGTTATTCAATTACCTCTTTTGATCGCTCTTTCT
GAACGCAAGATGTTTTCCAAAAGCGTGGTTTAAGATTTCTTTGAAAAAAATTTTAAATAT
TCAATTAGAGTTGAGGAAACTGACAGTTAGTAAGAAGCAGAAAAAAAAAGAAAAGAAAAT
AAAGAAGTTTTGATCACTTCAATATTAGCAATATTAAATAGCTTTATAACAATTAACACA
CAAACTTCTTTCTTTTAAGAGATGAAGATTGCACAAAGAAAACTAAACTTAAACTCATAT
GATGGATAAAGATTAAATAGTATTATTGCTTACACTATTGATTATATCATATCTCCATAA
TACAGAATATATGATTTCTTTACACTCTCTTATTAACTCATTTCACTTGCTGTAAAAGAT
GAAATTCTACATTCAAATGTCATGCTTTATCACAAACATATTGCTTTCTTTAAAGCTACC
AAGTAATCACCTTAGTTAATTTTCTTATCTGCAGATGCATAATAGAATACTACCTAAATG
TTTATAGATTCTACTCCCTTTATCAATGTCTTTTTTAATAACTTAGAATTATTCTTCCCT
GAATTTAGATAAAAGGATCTTCAAAATATAAAAGATAAAAAAGAAGCTAATAATGAAATA
GATTAAGCAGATAAGTAAGAAGAAAAAGAGAATAAAGAAGATATTAAGATAAAGGAAATA
AATATATTTGATAAAGTAAATGACTTTGAGGTATACAAACAAAATATGCACTAAATTATT
ATCACTATAATTTAAGCAAGAGAAAGGGAGAAAATGTTCATAAAAGACATTGAATTATTC
TGCAAAAGTTGTCTTCACTACCCATCAAATCTCTTGAAATATGCTTAAGAAGTTTGTAAA
ACAAAGGATAATGAAAAGCTTACTGAAAGTGATGACATCATTCTCCTGCAATAATACGAA
ACATAATATTTCCCTAAAAACTTTTTAAGAGTTTATGAGGATATTTACAAAGCAATATAA
GTTTTGTAAAGCAAAAATGAATTGACTATATACCCATATATTGGAACAAATAACGATTTA
CAGGGATTTTTCTAATATCAAATAGATTTAATTGAAAGAATTTTGATGAACCCAAATTAT
TAACAAAAATTGATTGAATAAATTACTTAAGACTCCTAATATCATCACATTTCATTCTTT
TTCTCAATTGTGATTTACTTTACATTGAAATTCCTTAAGTCATACAAAAATTCAGAAAAT
TTAAATGAAGAAACATCAAACAATTATAAAGAAATTTTAGAGATGTACAAAAATGAAGAG
ACAATTAAAGGTCTGAAAAAGTAAATTGAAGAAGAGCTAAATTTATCAAAGAAGAGACTT
ACTGATACAAGTGAAAAATAAATCTTAAAAGCATTTTTAGATATGTTAGACTACATCAAC
GATGTTTAAAAAATAGAATGA