Identifiers and Description

Gene Model Identifier

TTHERM_00082230

Standard Name

CTH14 (CaTHepsin 14)

Aliases

PreTt16269 | 6.m00343 | 3836.m01942

Description

Eukaryotic aspartyl protease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00026 ) Eukaryotic aspartyl protease
  • ( PF08763 ) Voltage gated calcium channel IQ

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 81.3%

TetraMine Data

TTHERM_00082230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02366.19.997093137033517e-262eukaryotic aspartyl protease (
509 aa)
OxytrichaContig9053.0.g206.999359373303508e-39Eukaryotic aspartyl protease
SGDYPL154C4.000054831110256e-33PEP4 Vacuolar aspartyl proteas
e (proteinase A), required for
the posttranslational precurs
or maturation of vacuolar prot
einases; important for protein
turnover after oxidative dama
ge; synthesized as a zymogen,
self-activates
WormBaseWBGene000002175.001425520048966e-32locus:asp-4 status:Confirmed
UniProt:Q21966 protein_id
:CAA90633.1
DictyBaseDDB_G02794119.998720540547892e-23ctsD on chromosome: 3 position
2104523 to 2105867
Stentor CoeruleusSteCoe_295296.305116760146989e-16

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00082230(coding)
ATGAATTAAAAGTTACTATTTATACTAATTGCCTTAGCATCCATCTTTTTTAACTAAGTA
GCATGCTCAGAAAAGGTAGAAATTGATCTTGTACATACCTTAAGATAAAAATTTGATATA
AAGAGTGTAACATCTGGAGAATTTTAAAAAATTAGGAATCAAAAGATTTAGCAAATAATT
TAAAAGTTCGAAAAATAAAATAAAGCATAGATAAATAAGTTAAATTTAGCATCAACACCT
CAAGAAATAGAAGAAAATATTCATAGAAGCTATTCTACATTCAAAGAAATCGTGACTCTC
ACAAATTTTATTAACTTTTAATATATTGGTTAAATCAAAGTTGGATCATCAAATTAGTAA
TTTACAGTACTTTTTGATACAGGCTCGAATCAGCTTTGGTTACCTTAGGATTAATGCTAG
TAATGCACTTTTGCAAATAGTAGATATACATGTCAAACAAATACTTGTTCTAATACAACT
TAAGATATTGCATACGGTTAAGGCAAAGTGAAAGGATATAATTCGAAAGATTTAATCACT
GTAGGTAATAAGTCTACTTTTTACCCTTTTCTTTCTGTCTTTTAAGCTTAAGATTTAGAT
GGATTCTAGAGTGATGGAATAATGGGAATGGGTGTATCTAAAAAGGACAGTCTAGTTAAT
AAATTGTATATGGAGAAAAAAATAGAAAAAAATTAATTTTCTTTTAAGCTTTCTTCAATT
GATTTAAGTTAGTATTCAAAAGACCAACAAAACATGGCAACAGATAAGAATTCATAATTA
ATATTAGGTGGATATGATGATTAGTTAATAAGTGAAGACAGTATAAATTATTTCTAGGTT
GTAAGCAAAAGTTATTGGGCTATTAAAATGCGTTCAGCAAGATATAATAAGTAAGACATT
TTTAATGGCAAAAATGAATTAAGATTAGCTTTGATCGACACTGGTACTAGTTTGATTCAT
ATGCCTACAGCTGATTATTAAGCATTTAATAGGACGGTATTAGAAAAATCAAGCAATAAA
GGATGCTTCGAGTTTGGATTGCTTATATGTGTGTGTAATTAGAAACAAATACCTAATTTC
CCAACAATTAGTTTAACTTTTACAGATGTTGATAATAATGACCAAATAATTAATATTTTA
CCAGAATATTACATCATGTATTAAGATGGTTTTTGTGTATACTTGGTAGCTGAATTTCCT
GATATGGGCATTAACAATATGTGGATATTAGGAGATGTTTTTATGAGATAGACATATAAC
ATATTTGACTATGATAGACAAGCTATTGGTATTGTTAATTTGTAGCCAGAAGACGAAGAA
GGTCATCAAATAAAAAGTGGTACATTTAGTGGCTTTGGTAAATTAGTTATAATGCTATTA
GTAATTGGTATTGGAGCCTTTTTAGCAAATTACATTTATTAAAATTACATTAAAAACAAT
TCCAATAACTAATAACAAAACTATCAAGGCAACTATTAATAATATTAGCCTTAGTAAAGC
TATTAACCTCCTTAGTAATATTACTAATAATAGCCTCCTCAGCAATACTATCAATAGCCA
CCAGCTTAATATAATAACTAAAACTATTAAAACATTCCTCTTTAGCCATTAAACTAGTAA
TAAGTTTGA


>TTHERM_00082230(protein)
MNQKLLFILIALASIFFNQVACSEKVEIDLVHTLRQKFDIKSVTSGEFQKIRNQKIQQII
QKFEKQNKAQINKLNLASTPQEIEENIHRSYSTFKEIVTLTNFINFQYIGQIKVGSSNQQ
FTVLFDTGSNQLWLPQDQCQQCTFANSRYTCQTNTCSNTTQDIAYGQGKVKGYNSKDLIT
VGNKSTFYPFLSVFQAQDLDGFQSDGIMGMGVSKKDSLVNKLYMEKKIEKNQFSFKLSSI
DLSQYSKDQQNMATDKNSQLILGGYDDQLISEDSINYFQVVSKSYWAIKMRSARYNKQDI
FNGKNELRLALIDTGTSLIHMPTADYQAFNRTVLEKSSNKGCFEFGLLICVCNQKQIPNF
PTISLTFTDVDNNDQIINILPEYYIMYQDGFCVYLVAEFPDMGINNMWILGDVFMRQTYN
IFDYDRQAIGIVNLQPEDEEGHQIKSGTFSGFGKLVIMLLVIGIGAFLANYIYQNYIKNN
SNNQQQNYQGNYQQYQPQQSYQPPQQYYQQQPPQQYYQQPPAQYNNQNYQNIPLQPLNQQ
QV


>TTHERM_00082230(gene)
TTAATTAATTGTTTTTCTACAAAAAAGATGAATTAAAAGTTACTATTTATACTAATTGCC
TTAGCATCCATCTTTTTTAACTAAGTAGCATGCTCAGAAAAGGTAGAAATTGATCTTGTA
CATACCTTAAGATAAAAATTTGATATAAAGAGTGTAACATCTGGAGAATTTTAAAAAATT
AGGAATCAAAAGATTTAGCAAATAATTTAAAAGTTCGAAAAATAAAATAAAGCATAGATA
AATAAGTTAAATTTAGCATCAACACCTCAAGAAATAGAAGAAAATATTCATAGAAGCTAT
TCTACATTCAAAGAAATCGTGACTCTCACAAATTTTATTAACTTTTAATATATTGGTTAA
ATCAAAGTTGGATCATCAAATTAGTAATTTACAGTACTTTTTGATACAGGCTCGAATCAG
CTTTGGTTACCTTAGGATTAATGCTAGTAATGCACTTTTGCAAATAGTAGATATACATGT
CAAACAAATACTTGTTCTAATACAACTTAAGATATTGCATACGGTTAAGGCAAAGTGAAA
GGATATAATTCGAAAGATTTAATCACTGTAGGTAATAAGTCTACTTTTTACCCTTTTCTT
TCTGTCTTTTAAGCTTAAGATTTAGATGGATTCTAGGTAAAATATTATTAATATGCTAAT
ATATTAATATAAAATATTTGTTTTAAAATTAAATTTAGAGTGATGGAATAATGGGAATGG
GTGTATCTAAAAAGGACAGTCTAGTTAATAAATTGTATATGGAGAAAAAAATAGAAAAAA
ATTAATTTTCTTTTAAGCTTTCTTCAATTGATTTAAGTTAGTATTCAAAAGACCAACAAA
ACATGGCAACAGATAAGAATTCATAATTAATATTAGGTGGATATGATGATTAGTTAATAA
GTGAAGACAGTATAAATTATTTCTAGGTTGTAAGCAAAAGTTATTGGGCTATTAAAATGC
GTTCAGCAAGATATAATAAGTAAGACATTTTTAATGGCAAAAATGAATTAAGATTAGCTT
TGATCGACACTGGTACTAGTTTGATTCATATGCCTACAGCTGATTATTAAGCATTTAATA
GGACGGTATTAGAAAAATCAAGCAATAAAGGATGCTTCGAGTTTGGATTGCTTATATGTG
TGTGTAATTAGAAACAAATACCTAATTTCCCAACAATTAGTTTAACTTTTACAGATGTTG
ATAATAATGACCAAATAATTAATATTTTACCAGAATATTACATCATGTATTAAGATGGTT
TTTGTGTATACTTGGTAGCTGAATTTCCTGATATGGGCATTAACAATATGTGGATATTAG
GAGATGTTTTTATGAGATAGACATATAACATATTTGACTATGATAGACAAGCTATTGGTA
TTGTTAATTTGTAGCCAGAAGACGAAGAAGGTCATCAAATAAAAAGTGGTACATTTAGTG
GCTTTGGTAAATTAGTTATAATGCTATTAGTAATTGGTATTGGAGCCTTTTTAGCAAATT
ACATTTATTAAAATTACATTAAAAACAATTCCAATAACTAATAACAAAACTATCAAGGCA
ACTATTAATAATATTAGCCTTAGTAAAGCTATTAACCTCCTTAGTAATATTACTAATAAT
AGCCTCCTCAGCAATACTATCAATAGCCACCAGCTTAATATAATAACTAAAACTATTAAA
ACATTCCTCTTTAGCCATTAAACTAGTAATAAGTTTGA