Identifiers and Description

Gene Model Identifier

TTHERM_00037350

Standard Name

CTH13 (cathepsin 13)

Aliases

PreTt14470 | 2.m02406 | 3825.m02840

Description

Eukaryotic aspartyl protease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00037350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00990.19.997093137033517e-262eukaryotic aspartyl protease (
563 aa)
OxytrichaContig18566.0.g983.999374135750469e-31Eukaryotic aspartyl protease
SGDYPL154C6.999211576891585e-27PEP4 Vacuolar aspartyl proteas
e (proteinase A), required for
the posttranslational precurs
or maturation of vacuolar prot
einases; important for protein
turnover after oxidative dama
ge; synthesized as a zymogen,
self-activates
DictyBaseDDB_G02794114.0013320766793207e-25ctsD on chromosome: 3 position
2104523 to 2105867
WormBaseWBGene000002173.9989916100764785e-24locus:asp-4 status:Confirmed
UniProt:Q21966 protein_id
:CAA90633.1
Stentor CoeruleusSteCoe_107380.000000000005109089028063325

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00037350(coding)
ATGATTGCAAATTAAAAAACTATTGCAGTGATATTTTTAATTGTTTTGAGCAATATATTT
GCAAGTTGCCAAAAAGATTAAGTAAAAATACACGAATTTAAAATATGTTAGAGCAGTAGT
AATTAGAGGTTGTTAAAAAGTGCTTCAGAGGAGAATAATGAAACCAAAGAGTTTAAAGAT
AGTGACAATTAAGAAAAGAAAGAAGGAAAAGGTTCTTAAATTCTTTTACCTCTTATTAAC
ATGTTGAATTTGCATTATGATACTGAGCTCTACTTTGGAAAGAACAAGCAACCCTTTAAA
TTAATTATAGATACAGGTTCCACTGCTTTGTGGATTCCAGATATTGATTGTATTAATTGC
AAACAGAATAACCTATGGAAGCTTTACAATTGCGACAAAAGTAGTACTTGTCATTCATAA
AATAAAGATGATATGATAAACATTGAATATGGAGTTGGGTCTGTAGATGGATATGTTGTG
AAAGAGAATATTTATTTAAGTGATAAAGATTAAACTGGATTCGAATACGAATTTCTATTA
GTAAAGAATGTCACTAACTTTAAGGTTTTACAAATATAAGGAATCATAGGTTTAGGCAGA
GAAGAAAGCAGTGAGTTTAATCATTAGACAATTTTAGGGAGCATGAAAAAAAAAGGTGTC
ATTGATTAAAGGGTATTCTCATTGTTTTTGAGTGACTCAAGTTGTTTAGGAAATAGTGTT
TTGGTCTTTGGAGGATATAATGAAGATTATACCTAAGGCCCTATTTCATATATTAGTGTA
AATACAAACGAAATGTGGAGTGTCGAAATATCATAAGCTGCTTTGGCTTTAAATACTCAA
AGCGATTCTAGTAATTAAAATGAAAAGAAAAAGTCGTTATTGTAATTCTCAACTGATACA
GTAATCATAGATAGTGGTACCACAAAAATCGTACTTCCAAAACCAGACTTAAGTGCATTA
ATGGATTTATTAAAATAAGATTTTGGAATTGTCTGCGAATTAGAGAAACGTTCTGCATCA
GCAGAAATATTTACTTTGGTTTGTGCAGAATCAGACTATTTAAAATATCCTTCCTTTATA
TTTACTTTGGGTTCAACTCCATCGGAATAAAAAGAATTTGAACTTACAGGGGAAGAATAT
ATTGAATCTTGCTTCTATCATTTGTAAGTTCGTAAGTGTGCTTTACGTTTCTAATATGTA
GAAACTGATTACATTTTGTTAGGTGATACATTCCTACGTAAATACTACACAATTTTTGAT
ATGGATAATCAAAGAATAGGCTTTGCCTTAGCCAAAGTTATCCAACCTAAACCATTCTAT
GAGACTCCCATTTTTAGTGCTTACTTAGGTTTAGGAATAACAATTGGCTTCCTCTTATTT
TTCTTGTTAATGTGTAAGATTCGCTCTATTTGGCAAGAGAGAAACTTTGAAAGGCTGCAT
TCAGTTAAAGCTCAAGCTGATTCTCCACCAAATACCACAGGTCCAGATGATCTTCATAGT
CATTAAAGACCAGGACACATAGAAATGTAACAAGGTAATGACTAAAGCATTGAAGATCCT
AATGACATTTCTGAAGAAATTTCTTAAGACGATATCTCTGATATTGACTAATCTTAAAAT
AAGAATTAATAATCATATAGATTACCTGTTCAGAAAAAAGAGTGA


>TTHERM_00037350(protein)
MIANQKTIAVIFLIVLSNIFASCQKDQVKIHEFKICQSSSNQRLLKSASEENNETKEFKD
SDNQEKKEGKGSQILLPLINMLNLHYDTELYFGKNKQPFKLIIDTGSTALWIPDIDCINC
KQNNLWKLYNCDKSSTCHSQNKDDMINIEYGVGSVDGYVVKENIYLSDKDQTGFEYEFLL
VKNVTNFKVLQIQGIIGLGREESSEFNHQTILGSMKKKGVIDQRVFSLFLSDSSCLGNSV
LVFGGYNEDYTQGPISYISVNTNEMWSVEISQAALALNTQSDSSNQNEKKKSLLQFSTDT
VIIDSGTTKIVLPKPDLSALMDLLKQDFGIVCELEKRSASAEIFTLVCAESDYLKYPSFI
FTLGSTPSEQKEFELTGEEYIESCFYHLQVRKCALRFQYVETDYILLGDTFLRKYYTIFD
MDNQRIGFALAKVIQPKPFYETPIFSAYLGLGITIGFLLFFLLMCKIRSIWQERNFERLH
SVKAQADSPPNTTGPDDLHSHQRPGHIEMQQGNDQSIEDPNDISEEISQDDISDIDQSQN
KNQQSYRLPVQKKE


>TTHERM_00037350(gene)
ATGATTGCAAATTAAAAAACTATTGCAGTGATATTTTTAATTGTTTTGAGCAATATATTT
GCAAGTTGCCAAAAAGATTAAGTAAAAATACACGAATTTAAAATATGTTAGAGCAGTAGT
AATTAGAGGTTGTTAAAAAGTGCTTCAGAGGAGAATAATGAAACCAAAGAGTTTAAAGAT
AGTGACAATTAAGAAAAGAAAGAAGGAAAAGGTTCTTAAATTCTTTTACCTCTTATTAAC
ATGTTGAATTTGCATTATGATACTGAGCTCTACTTTGGAAAGAACAAGCAACCCTTTAAA
TTAATTATAGATACAGGTTCCACTGCTTTGTGGATTCCAGATATTGATTGTATTAATTGC
AAACAGAATAACCTATGGAAGCTTTACAATTGCGACAAAAGTAGTACTTGTCATTCATAA
AATAAAGATGATATGATAAACATTGAATATGGAGTTGGGTCTGTAGATGGATATGTTGTG
AAAGAGAATATTTATTTAAGTGATAAAGATTAAACTGGATTCGAATACGAATTTCTATTA
GTAAAGAATGTCACTAACTTTAAGGTTTTACAAATATAAGGAATCATAGGTAATTATTTT
AACCAAATTCTTAATATTTAAATTTTAGAGAAAATATATTCAATTGAAATTTTCTAAACG
TTAGAAGGAGTTTCTTCTTTTAATTTTATAACACATACAAAAAAGCAAGCAATAAATCAA
TCAAACAATAAATAAATTATCAGATTTTCCGAAAAATTTCATAGATTTTTTTAATTTTTT
TTATAATGGACTCGAATTTTGAATTCTGATTAAATAACATTTTAGAAATTATGCTGAAAT
ACTTTTTTTCTCAATTTCTTTAAAGAAAAAAATGTTAGATCTAGGCAGCAAAATTTTCTC
TTCTTAGAAATACTTTGATTTATTTTATTTATCTAAACAGAATAAATAAATAAATTGATA
AAGAAATAATAAATTATCAAATATGGTTATTTTTATTATTAAATGGTTTTCAAGTATTTT
AATATAAAATAATCAAATATTGATCATAAAATTAAACAAATTATTTTTATTTATTCACTT
TATTAATATTTATATAATGAGTTGATTAGTTGTTTATTAAAATTTACTTTCTACTTTAGG
TTTAGGCAGAGAAGAAAGCAGTGAGTTTAATCATTAGACAATTTTAGGGAGCATGAAAAA
AAAAGGTGTCATTGATTAAAGGGTATTCTCATTGTTTTTGAGTGACTCAAGTTGTTTAGG
AAATAGTGTTTTGGTCTTTGGAGGATATAATGAAGATTATACCTAAGGCCCTATTTCATA
TATTAGTGTAAATACAAACGAAATGTGGAGTGTCGAAATATCATAAGCTGCTTTGGCTTT
AAATACTCAAAGCGATTCTAGTAATTAAAATGAAAAGAAAAAGTCGTTATTGTAATTCTC
AACTGATACAGTAATCATAGATAGTGGTACCACAAAAATCGTACTTCCAAAACCAGACTT
AAGTGCATTAATGGATTTATTAAAATAAGATTTTGGAATTGTCTGCGAATTAGAGAAACG
TTCTGCATCAGCAGAAATATTTACTTTGGTTTGTGCAGAATCAGACTATTTAAAATATCC
TTCCTTTATATTTACTTTGGGTTCAACTCCATCGGAATAAAAAGAATTTGAACTTACAGG
GGAAGAATATATTGAATCTTGCTTCTATCATTTGTAAGTTCGTAAGTGTGCTTTACGTTT
CTAATATGTAGAAACTGATTACATTTTGTTAGGTGATACATTCCTACGTAAATACTACAC
AATTTTTGATATGGATAATCAAAGAATAGGCTTTGCCTTAGCCAAAGTTATCCAACCTAA
ACCATTCTATGAGACTCCCATTTTTAGTGCTTACTTAGGTTTAGGAATAACAATTGGCTT
CCTCTTATTTTTCTTGTTAATGTGTAAGATTCGCTCTATTTGGCAAGAGAGAAACTTTGA
AAGGCTGCATTCAGTTAAAGCTCAAGCTGATTCTCCACCAAATACCACAGGTCCAGATGA
TCTTCATAGTCATTAAAGACCAGGACACATAGAAATGTAACAAGGTAATGACTAAAGCAT
TGAAGATCCTAATGACATTTCTGAAGAAATTTCTTAAGACGATATCTCTGATATTGACTA
ATCTTAAAATAAGAATTAATAATCATATAGATTACCTGTTCAGAAAAAAGAGTGA