Identifiers and Description

Gene Model Identifier

TTHERM_00629950

Standard Name

CTH125 (cathepsin 125)

Aliases

PreTt06517 | 89.m00111 | 3831.m01412

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00629950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04244.17.003368684633018e-175papain family cysteine proteas
e containing protein (328 aa)
WormBaseWBGene000007769.997863464222902e-69locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
OxytrichaContig19092.0.g431.0004460510701209e-64Papain family cysteine proteas
e
DictyBaseDDB_G02838673.999543040313994e-55cprC on chromosome: 4 position
1092858 to 1094270
Stentor CoeruleusSteCoe_270841.462486227251231e-31

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00629950(coding)
ATGAAACTTTTACTTGGCTCTTTGATTTTAATTGGTTTGAGCTTATCTGCTTTGACCTAC
TTGAGTTTGGAAAAACCTCACCATGATCTCGAATCTATTCAAGATGTTAAACAACAATTC
GAAAAGTACTTATAGTAATTCGGTATTGTCATCAAGAATGCTGAAGAACGTATTTACAGA
TTGAAGGTCTTCATTTAAAACGTTGCTGAAATTGTTGCTCACAATAAGCTTTCCAACAAG
ACCTACACTCAAGGTATTAACTAATTCGCTCACATGACTGATGAAGAATTTGCTCAAACT
TATCTTACCCTTGAAGATCGTGAAAAGGAAACTCTTAACATCTAATAATTCTAATCAAAT
GATATCCCTGAATCTGTTGACTGGAGAACCTAGGGTGCTGTTACTGAAGTTAAAAACTAA
GGTGGCTGTGGTTCTTGCTACGCATTCTCTGCTGCTGGTGCTCTTGAAGGTCTCCACGCT
TAACAAACTGGAAACTTAACTAGCTTCTCATCTCAACAAATTATCGATTGCTCATGGAAA
TACCATAACCACGGATGCCACGGTGGTTTCATGGATAATGTTTTCAATTACGTTAAAGAT
CACGGTATTGAACTAGACTAAGACTATCCTTATGTTGGTCACGTCCACTTATTCAAATGC
TTGAATAACCCTGATGCTTACCACTATTCTATCAAGGGCCACTATGATATTAAGGCTGGT
GATTGCCAAGGTTTATAAGTAGCTATTGCTTAACAACCTGTTTCAGTTGCTATTGATGCT
AGAGTACTTAAGAAATACAGTTCTGGTATTGTTACTGAATGTGGTAGAAGAATTAAGCTT
AACCACGGTGTTTTGGCAGTTGGTTACGATGCTGATTCTTTAATTATCAAGAATTCTTGG
GGTACTAGATGGGGTGAATAAGGATACTTCAGACTTGGCAAGAATAACACTTGCGGTGTT
TGCTAAGCTGCTTCTTATCCTATCCCTCTTTGA


>TTHERM_00629950(protein)
MKLLLGSLILIGLSLSALTYLSLEKPHHDLESIQDVKQQFEKYLQQFGIVIKNAEERIYR
LKVFIQNVAEIVAHNKLSNKTYTQGINQFAHMTDEEFAQTYLTLEDREKETLNIQQFQSN
DIPESVDWRTQGAVTEVKNQGGCGSCYAFSAAGALEGLHAQQTGNLTSFSSQQIIDCSWK
YHNHGCHGGFMDNVFNYVKDHGIELDQDYPYVGHVHLFKCLNNPDAYHYSIKGHYDIKAG
DCQGLQVAIAQQPVSVAIDARVLKKYSSGIVTECGRRIKLNHGVLAVGYDADSLIIKNSW
GTRWGEQGYFRLGKNNTCGVCQAASYPIPL


>TTHERM_00629950(gene)
TTTGAAAATTTGTTTGTTAATCAAATGAAACTTTTACTTGGCTCTTTGATTTTAATTGGT
TTGAGCTTATCTGCTTTGACCTACTTGAGTTTGGAAAAACCTCACCATGATCTCGAATCT
ATTCAAGATGTTAAACAACAATTCGAAAAGTACTTATAGTAATTCGGTATTGTCATCAAG
AATGCTGAAGAACGTATTTACAGATTGAAGGTCTTCATTTAAAACGTTGCTGAAATTGTT
GCTCACAATAAGCTTTCCAACAAGACCTACACTCAAGGTATTAACTAATTCGCTCACATG
ACTGATGAAGAATTTGCTCAAACTTATCTTACCCTTGAAGATCGTGAAAAGGAAACTCTT
AACATCTAATAATTCTAATCAAATGATATCCCTGAATCTGTTGACTGGAGAACCTAGGGT
GCTGTTACTGAAGTTAAAAACTAAGGTGGCTGTGGTTCTTGCTACGCATTCTCTGCTGCT
GGTGCTCTTGAAGGTCTCCACGCTTAACAAACTGGAAACTTAACTAGCTTCTCATCTCAA
CAAATTATCGATTGCTCATGGAAATACCATAACCACGGTAATATTTTTTATATATTCATA
ATTGATCATAATAATTAACTATTATTTAATTAATTATAAAGGATGCCACGGTGGTTTCAT
GGATAATGTTTTCAATTACGTTAAAGATCACGGTATTGAACTAGACTAAGAGTAAAAACT
TAATTATTCAAATAGAAACAATTAGTTAATTATATTTATAAAATAAAAGCTATCCTTATG
TTGGTCACGTCCACTTATTCAAATGCTTGAATAACCCTGATGCTTACCACTATTCTATCA
AGGGCCACTATGATATTAAGGCTGGTGATTGCCAAGGTTTATAAGTAGCTATTGCTTAAC
AACCTGTTTCAGTTGCTATTGATGCTAGAGTACTTAAGAAATACAGTTCTGGTATTGTTA
CTGAATGTGGTAGAAGAATTAAGCTTAACCACGGTGTTTTGGCAGTTGGTTACGATGCTG
ATTCTTTAATTATCAAGAATTCTTGGGGTACTAGATGGGGTGAATAAGGATACTTCAGAC
TTGGCAAGAATAACACTTGCGGTGTTTGCTAAGCTGCTTCTTATCCTATCCCTCTTTGA