Identifiers and Description

Gene Model Identifier

TTHERM_01354260

Standard Name

CTH121 (cathepsin 121)

Aliases

PreTt17099 | 343.m00014

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00068 ) Phospholipase A2
  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 92.3%

TetraMine Data

TTHERM_01354260

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13352.14.999717172196908e-122papain family cysteine proteas
e containing protein (333 aa)
OxytrichaContig1254.0.g801.0002546821282671e-50Papain family cysteine proteas
e
DictyBaseDDB_G02728154.9986056260133516e-43cprE on chromosome: 2 position
2212329 to 2213613
WormBaseWBGene000007762.00017271388466e-38locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
Stentor CoeruleusSteCoe_293039.602680054508676e-24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01354260(coding)
ATGAATAAATTGATCCTTTTGAGTATTATCATGCTCATGCCTCTCTGTTTGGCTCAAAAT
ATAAGTGTAGAAAAACTTCTTGCTTATAATAAATGGTCAAGCTAACATCAAAGAGTTTAT
CTGAATGAAGATGAAAAACTATTTAGACAAATGGTTTTCTTTGAGAACTTGTAAAAGATT
TAGGAACATAACAGTGATCCTAATAACACCTATTCTATCAATTTAAACTAATTCTCAGAT
ATGACTAAAGAAGAATTTGCTGAAAAAATTCTTATGAAATCCGATTTTGTTGACCATTTA
ATGAAAGGAATCAGTTAAGAGACAACTCATAATGATGCTAATAAAGAAACTTAGTTCAAT
TCAAAAGGCGTTTCTTATGCTTATTCAATAGACTGGAGAACAAAAGGTGCTGTAACATCG
GTTAAGGATTAAGGTAGTTGTGGTTCATGCTGGAGTTTCTCTGCAGCTGGAGTAATGGAG
TCATATAACTTCATTAGAAACAAAGCTGCTTTAGTTGATTTTTCTGAGTAATAACTTGTT
GATTGTGTCATCCCTGCAAATGGTTACAACTCTTATGGATGTGGTGGAGGATGGCCTGCT
TCTTGTCTGGATTATGCCTCCAAAGTAGGTATTACTACCCTAGACAAGTATCCCTATGTT
GCAGTTTAGAATAATTGTAATGTGACTGATACAAATAATGGCTTTAAGCCTAAAAACTGG
ATTTAAGTTGCTAACACGCCTGATGACTTAAAAATGGCTTTGAATTGGACTCCTGTTTCT
GTAGTTGTTGATGCTTCCAATTGGGGTAGTTATTACTCTGGAATTTTCAACGGATGTGAT
TAATCTCATATTAGTCTTAATCATGCTGTGTTAGCTGTTGGTTATGACTTACAAGGAAAC
TGGATTCTTAAAAATTCTTGGAGCGCCTATTGGGGTGAGAATGGCTATATGAGACTTGCT
GCTAACAACACATGCGGTATCTTAAGCTATAATTATTTAGTTACTGCTTGA


>TTHERM_01354260(protein)
MNKLILLSIIMLMPLCLAQNISVEKLLAYNKWSSQHQRVYLNEDEKLFRQMVFFENLQKI
QEHNSDPNNTYSINLNQFSDMTKEEFAEKILMKSDFVDHLMKGISQETTHNDANKETQFN
SKGVSYAYSIDWRTKGAVTSVKDQGSCGSCWSFSAAGVMESYNFIRNKAALVDFSEQQLV
DCVIPANGYNSYGCGGGWPASCLDYASKVGITTLDKYPYVAVQNNCNVTDTNNGFKPKNW
IQVANTPDDLKMALNWTPVSVVVDASNWGSYYSGIFNGCDQSHISLNHAVLAVGYDLQGN
WILKNSWSAYWGENGYMRLAANNTCGILSYNYLVTA


>TTHERM_01354260(gene)
ATGAATAAATTGATCCTTTTGAGTATTATCATGCTCATGCCTCTCTGTTTGGCTCAAAAT
ATAAGTGTAGAAAAACTTCTTGCTTATAATAAATGGTCAAGCTAACATCAAAGAGTTTAT
CTGAATGAAGATGAAAAACTATTTAGACAAATGGTTTTCTTTGAGAACTTGTAAAAGATT
TAGGAACATAACAGTGATCCTAATAACACCTATTCTATCAATTTAAACTAATTCTCAGAT
ATGACTAAAGAAGAATTTGCTGAAAAAATTCTTATGAAATCCGATTTTGTTGACCATTTA
ATGAAAGGAATCAGTTAAGAGACAACTCATAATGATGCTAATAAAGAAACTTAGTTCAAT
TCAAAAGGCGTTTCTTATGCTTATTCAATAGACTGGAGAACAAAAGGTGCTGTAACATCG
GTTAAGGATTAAGGTAGTTGTGGTTCATGCTGGAGTTTCTCTGCAGCTGGAGTAATGGAG
TCATATAACTTCATTAGAAACAAAGCTGCTTTAGTTGATTTTTCTGAGTAATAACTTGTT
GATTGTGTCATCCCTGCAAATGGTTACAACTCTTATGGATGTGGTGGAGGATGGCCTGCT
TCTTGTCTGGATTATGCCTCCAAAGTAGGTATTACTACCCTAGACAAGTATCCCTATGTT
GCAGTTTAGAATAATTGTAATGTGACTGATACAAATAATGGCTTTAAGCCTAAAAACTGG
ATTTAAGTTGCTAACACGCCTGATGACTTAAAAATGGCTTTGAATTGGACTCCTGTTTCT
GTAGTTGTTGATGCTTCCAATTGGGGTAGTTATTACTCTGGAATTTTCAACGGATGTGAT
TAATCTCATATTAGTCTTAATCATGCTGTGTTAGCTGTTGGTTATGACTTACAAGGAAAC
TGGATTCTTAAAAATTCTTGGAGCGCCTATTGGGGTGAGAATGGCTATATGAGACTTGCT
GCTAACAACACATGCGGTATCTTAAGCTATAATTATTTAGTTACTGCTTGA