Identifiers and Description

Gene Model Identifier

TTHERM_00561510

Standard Name

CTH12 (cathepsin 12)

Aliases

PreTt27912 | 74.m00189 | 3720.m00079

Description

Eukaryotic aspartyl protease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00026 ) Eukaryotic aspartyl protease
  • ( PF00473 ) Corticotropin-releasing factor family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 68.2%

TetraMine Data

TTHERM_00561510

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16132.13.0005183738819142e-162eukaryotic aspartyl protease (
515 aa)
DictyBaseDDB_G02794112.0003218023735366e-33ctsD on chromosome: 3 position
2104523 to 2105867
SGDYPL154C7.001594317853847e-31PEP4 Vacuolar aspartyl proteas
e (proteinase A), required for
the posttranslational precurs
or maturation of vacuolar prot
einases; important for protein
turnover after oxidative dama
ge; synthesized as a zymogen,
self-activates
WormBaseWBGene000002172.998800627344286e-26locus:asp-4 status:Confirmed
UniProt:Q21966 protein_id
:CAA90633.1
OxytrichaContig18588.0.g1101.0000422327488734e-24Eukaryotic aspartyl protease
Stentor CoeruleusSteCoe_217260.0000000000002543665647376923

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00561510(coding)
ATGAGGTTTTTATTTGTGTTAAGCTTGGCTCTAAGCTTTTAAATAACTTTTTAAAATATA
TTAAATATTCCCCTGACAAAATAGGAGGCCAATAATGAATCAGTTAAGCAAAATAGAAGC
TTTTTACAATCATATAGTGTTAATTCTTTGGTTAACTATGAATTGGCACACTATTATGGT
ACTATTCAAGTTGGGAGTTAGAATCAAACATTTAAGGTTAATTTTGATACAGGTTCAGAT
ACCTTATGGATACCTAGTAAAGATTGTGTCTAGAGTGGTAAATGCTAGGGATTAAATGTA
CACTATGATTGCTCTGCTTCAAATGGATGCAGTTAAACAACAAAATAATACTCTATATAA
TATGGAACAGGAGAAATTAGTGGTTATATAGCAACTACTACTGTCGGTGTTTGTGGACTT
TAGCAAGTTTAGTAGTCCTTCGTTTTAGTATAACAAACCTAAGACTTCTAAAATAGTTAA
TATGACTGTCTACTTGGTTTAGGAATGTATGATTTAATTAATGGTAATGGTAACTCATTT
GTTACTAATATGAAGAATAACGGAATAATTTAACAAGATATGTTTAGTTTTTATCTTGGA
TTTGGCAAGAGCGATTCTTAACTAGTTTTTGGAGGTTTTGATCCTAAAAAAGTAGCTGAC
ACTTCCTAAATTTATTTTCATCCAGTCACGTTAATTCAAAAAGAGTTGTAAAGATGGTAG
ATCCCAGTCAAATAAGTTAATTTTGAAAAATTTAGCTATAATTTAAGCATTAACAGTAAT
TTTGCTCTTGTTGACTCTGGAGCATCACTTATTTACTTAAGCAGTGATATGCACAGATAA
TTTTTTACATATTTGATTTAAAATTATAAAGTTTATGAGAAATCGAGTGAATATTATTAC
ACAAGTTGTAGTACCTCACTCCCCAACATAAATTTTATTTTAAATGACACTGATGGAATC
GAAAGATAATATTCTATTCCTTCATCTTTCTACTATATAGAGATCTAAGACGAATGTTTA
ATTGGCATTAAAAGAATGCCAGATAAATTGTCAGACGTGTAAATTATTCTTGGTAACGTT
TTCATGAGAAGATATGTTACTATATTTACTCATAATAACGCTACTATTGGTCTAACTCTA
TCAGTTGCTAATCCAGATGATGATTATAGAAATTATCCTCTTAAAGGATGGTAAATTGCT
CTTATTGTAGTAGGAGGAGTTTTAATTATAGGTGTTATTTCCTACTGTTTATACAGAAAA
GTAAAAGAAAGAAGAGAAAGAAATCGTAATTATCTAAATCAATAGCTGTTATCAAATTAA
AATCAGCAATAAATATATTTCTAAGGTTAAGATGTTGCTATAGATGGGGATTATTAAAAT
GATAACAATCATTAATAAGAATAAAATCAGTTCTAAGACTAAGGTGTTTTAATAGATGGC
GCAATAAATCATGACTAAAATAATAATTAAAATATTGTATATGGACAATCAGTTTAAGGA
TGA


>TTHERM_00561510(protein)
MRFLFVLSLALSFQITFQNILNIPLTKQEANNESVKQNRSFLQSYSVNSLVNYELAHYYG
TIQVGSQNQTFKVNFDTGSDTLWIPSKDCVQSGKCQGLNVHYDCSASNGCSQTTKQYSIQ
YGTGEISGYIATTTVGVCGLQQVQQSFVLVQQTQDFQNSQYDCLLGLGMYDLINGNGNSF
VTNMKNNGIIQQDMFSFYLGFGKSDSQLVFGGFDPKKVADTSQIYFHPVTLIQKELQRWQ
IPVKQVNFEKFSYNLSINSNFALVDSGASLIYLSSDMHRQFFTYLIQNYKVYEKSSEYYY
TSCSTSLPNINFILNDTDGIERQYSIPSSFYYIEIQDECLIGIKRMPDKLSDVQIILGNV
FMRRYVTIFTHNNATIGLTLSVANPDDDYRNYPLKGWQIALIVVGGVLIIGVISYCLYRK
VKERRERNRNYLNQQLLSNQNQQQIYFQGQDVAIDGDYQNDNNHQQEQNQFQDQGVLIDG
AINHDQNNNQNIVYGQSVQG


>TTHERM_00561510(gene)
ATGAGGTTTTTATTTGTGTTAAGCTTGGCTCTAAGCTTTTAAATAACTTTTTAAAATATA
TTAAATATTCCCCTGACAAAATAGGAGGCCAATAATGAATCAGTTAAGCAAAATAGAAGC
TTTTTACAATCATATAGTGTTAATTCTTTGGTTAACTATGAATTGGCACACTATTATGGT
ACTATTCAAGTTGGGAGTTAGAATCAAACATTTAAGGTTAATTTTGATACAGGTTCAGAT
ACCTTATGGATACCTAGTAAAGATTGTGTCTAGAGTGGTAAATGCTAGGTAAATTAACTA
TTGTGATCTTTTTAAATATAAACTTAAATTATCTAATATAAAAAATAGGGATTAAATGTA
CACTATGATTGCTCTGCTTCAAATGGATGCAGTTAAACAACAAAATAATACTCTATATAA
TATGGAACAGGAGAAATTAGTGGTTATATAGCAACTACTACTGTCGGTGTTTGTGGACTT
TAGCAAGTTTAGTAGTCCTTCGTTTTAGTATAACAAACCTAAGACTTCTAAAATAGTTAA
GTAAAAAACTTTTAAAAAATGACTATAAAAACTGAGTTTATCTAAAAAATACTTAATTTT
AAATTTTATAATAGTATGACTGTCTACTTGGTTTAGGAATGTATGATTTAATTAATGGTA
ATGGTAACTCATTTGTTACTAATATGAAGAATAACGGAATAATTTAACAAGATATGTTTA
GTTTTTATCTTGGATTTGGCAAGAGCGATTCTTAACTAGTTTTTGGAGGTTTTGATCCTA
AAAAAGTAGCTGACACTTCCTAAATTTATTTTCATCCAGTCACGTTAATTCAAAAAGAGT
TGTAAAGATGGTAGATCCCAGTCAAATAAGTTAATTTTGAAAAATTTAGCTATAATTTAA
GCATTAACAGTAATTTTGCTCTTGTTGACTCTGGAGCATCACTTATTTACTTAAGCAGTG
ATATGCACAGATAATTTTTTACATATTTGATTTAAAATTATAAAGTTTATGAGAAATCGA
GTGAATATTATTACACAAGTTGTAGTACCTCACTCCCCAACATAAATTTTATTTTAAATG
ACACTGATGGAATCGAAAGATAATATTCTATTCCTTCATCTTTCTACTATATAGAGATCT
AAGACGAATGTTTAATTGGCATTAAAAGAATGCCAGATAAATTGTCAGACGTGTAAATTA
TTCTTGGTAACGTTTTCATGAGAAGATATGTTACTATATTTACTCATAATAACGCTACTA
TTGGTAAGCACTTAGTTAATTCTATTATTAATTTATTTAACTTATTCTTTTACAAAAATA
AACTCAAAAAAACTAGCTTTAGAATCTATTCTTATAAAATATAATATTTTGAAATAGGGT
AAAATTTCAAAATTATTTTTTATAATTAAATATCAAACCCAAAAAATTAATCCAAACATT
ATTATTAATTAATAGCTGCTAGTTTATACCTCTACCATTTTTTTTAATTTGATAAAAGAT
TAAAATTTATTTATTTATTTATTTGATTGAGTAAATATCAAAAATACATTAAATTAAATT
TTTTTAAACTTAAAGGTCTAACTCTATCAGTTGCTAATCCAGATGATGATTATAGAAATT
ATCCTCTTAAAGGATGGTAAATTGCTCTTATTGTAGTAGGAGGAGTTTTAATTATAGGTG
TTATTTCCTACTGTTTATACAGAAAAGTAAAAGAAAGAAGAGAAAGAAATCGTAATTATC
TAAATCAATAGCTGTTATCAAATTAAAATCAGCAATAAATATATTTCTAAGGTTAAGATG
TTGCTATAGATGGGGATTATTAAAATGATAACAATCATTAATAAGAATAAAATCAGTTCT
AAGACTAAGGTGTTTTAATAGATGGCGCAATAAATCATGACTAAAATAATAATTAAAATA
TTGTATATGGACAATCAGTTTAAGGATGA