Identifiers and Description

Gene Model Identifier

TTHERM_00874740

Standard Name

CTH116 (cathepsin 116)

Aliases

PreTt14973 | 155.m00093

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 16.7%

TetraMine Data

TTHERM_00874740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17029.12.0009803861620222e-78hypothetical protein (1151 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00874740(coding)
ATGAGCAATATTATAAAAGTATTTGACATATTTTCAATGCCTTTTGCATTCAATTTAAAG
GAAAAGGAATATAAAAGAAAGACATTAGTTGGAGGCATTATTTCTTTAGTTATTATTTCG
ATATCAGCTATTTATTTTGGCTACTTATGCTATCTTTATTTTAATAATTACATTAATCCA
ACTATTAATGAAACCTACCAAACAATTGATTACGACTTTTCTATGCCTATAAGTAATAAT
TAAATGGCTTTTTAAATCTTTATGTCAAATGGCTAGACCCTCGATTAATACTAGCAAACA
GCTGGTGTGACTTATGCAATTCCTTTGGTAAATTATGTGTTTCCTGATTTTAATAATAAC
TCATAGTTAAAATAAACTCCTTTAAATATTATCAAATGCTCAGATGTTTCCTTAAATGGA
TTTTATTGCTTTGATTTTACTCCTATAAGTAACAATTAGAATCAAATGAATATAGGTTTT
GATAAAAATTAAATTGGAAACTACAGATTTGAAATTAGCATCGCTTTATGTAACACTTAG
CAGTTTATTTCTACTTATAATTGTGCAAATACTGCATAAATTTAAAGCGATTTTTTAAAA
ATAACAAATAAACTAACGCTAAAATTGACCACATAGAAATACAACACACAAACATAGCTT
TATTAACAATTTACTAAAAAGGAACAAATATCAATCCAAGATACTTTAACAAATATTTTA
AAAATTAATTTTTTAAAAACAAATTCTACCATCTAGTAGGGTTTTATTACTTAAAATAAT
CAATATCAAAATTATATATCTGATTATAATAAAGAAAATCTATACTTTACCTAATCTGCA
GTTTAGTAGCAAAACAAAAACAATTTGAATTTGGTATCAATAATACAAATTTAAATTGGC
AGCTATGAGTTAAAATAGAATATTCAATACCCATAATTCACATACATTCTTGCTTAATTT
ATGAGTGCATTTAATGTTATACTTGTTCTTGGAATTATTGCCTAAATTTCAGCTCAAAGC
GAAATTATTTAAGACTTTGCAGAAATTTAATTTAAGTTTAACTTTAAGCACAATGCATGG
AAATATTTAATATCTAAAAATGAGGGTAAAATTTAAGATGCATCCTTATCATAAAATTTA
ACAAAATTGCATTTTTAAATTTAAAATCTATCATTTAGGCAATATTTAGATAAATATTTA
AATTTAAGCTTCTTTAAAAGGACAAAGCTATTATTAATGAATAAATTATTTGATAAAGGA
GTTACTAAAAATCCATAAGAAAAGGTATTCTAAAAATTAATAGAGCAAGCTTCATAGCAG
TTTAGTATTGTTGATCTTTAAAAAGAGTTAATGTAAATGAAAATAATTTTAAAATTACTT
CTCTCACCTGAATAATATGCAGCTATTCAATTATGTGGTTACTTATTTAAAAATGAAAAT
CAAGATTTCAATCATGATTAATCAAATTAAAGATTAACAAACAATGAAAAGTAAAATTAA
TGTAATCATTTGAAACAAGACATAAAATAACAACAATAATAATAAGACAAGATAGTAAAA
GAGTTACTAAGTTAGGAAGATATCAAAAATGAGCTGGTTAAACTGAAAGCTATTTAATAG
CCGTAAGTTTAATTCGAGAATAAAGAAAAATAAGATTAAAAATCTTTATCAAAATAAGAA
AATGGGTTTATATCAAACTAAATTATATAAGAAGACATTTTAAATGAAAGAAAAGAAATT
AATTAAATAGAAAGTAATAAACTTTCTTTAAAGCTGCAAGATAAAGTTTATAAGAATAGT
ATCATTTATAAATAGAAGCAGGAATCACAAATCACTGATGATTATAATATCAATATCGAT
GATAATAAAATTGAATAGAGAAGTGAAAGTAGAATTGATAATCACTTAGAAATTATTGAA
TAGATAAATAATAATATGGAATAATTCTAAATATTCATCGAAAAGTTTTTAGATCAAAGA
AACACAAAATCTGAAATAGATAAGAGAATTTTAAGTTGTATGGCAGGTATCCATAACTAA
ATTATAAATAAGCACCAATTGTTTTGA


>TTHERM_00874740(protein)
MSNIIKVFDIFSMPFAFNLKEKEYKRKTLVGGIISLVIISISAIYFGYLCYLYFNNYINP
TINETYQTIDYDFSMPISNNQMAFQIFMSNGQTLDQYQQTAGVTYAIPLVNYVFPDFNNN
SQLKQTPLNIIKCSDVSLNGFYCFDFTPISNNQNQMNIGFDKNQIGNYRFEISIALCNTQ
QFISTYNCANTAQIQSDFLKITNKLTLKLTTQKYNTQTQLYQQFTKKEQISIQDTLTNIL
KINFLKTNSTIQQGFITQNNQYQNYISDYNKENLYFTQSAVQQQNKNNLNLVSIIQIQIG
SYELKQNIQYPQFTYILAQFMSAFNVILVLGIIAQISAQSEIIQDFAEIQFKFNFKHNAW
KYLISKNEGKIQDASLSQNLTKLHFQIQNLSFRQYLDKYLNLSFFKRTKLLLMNKLFDKG
VTKNPQEKVFQKLIEQASQQFSIVDLQKELMQMKIILKLLLSPEQYAAIQLCGYLFKNEN
QDFNHDQSNQRLTNNEKQNQCNHLKQDIKQQQQQQDKIVKELLSQEDIKNELVKLKAIQQ
PQVQFENKEKQDQKSLSKQENGFISNQIIQEDILNERKEINQIESNKLSLKLQDKVYKNS
IIYKQKQESQITDDYNINIDDNKIEQRSESRIDNHLEIIEQINNNMEQFQIFIEKFLDQR
NTKSEIDKRILSCMAGIHNQIINKHQLF


>TTHERM_00874740(gene)
CAAGGATATGAACCAAATGAATTAAAAAAGATTATTATTTAAAAATTTTTAGTAAGCTTT
AATTAATTTAAAAAACGTTCAAACTACTTTATAAGATAGACTAGTGTTAAATTAGAATAA
ATGAGCAATATTATAAAAGTATTTGACATATTTTCAATGCCTTTTGCATTCAATTTAAAG
GAAAAGGAATATAAAAGAAAGACATTAGTTGGAGGCATTATTTCTTTAGTTATTATTTCG
ATATCAGCTATTTATTTTGGCTACTTATGCTATCTTTATTTTAATAATTACATTAATCCA
ACTATTAATGAAACCTACCAAACAATTGATTACGACTTTTCTATGCCTATAAGTAATAAT
TAAATGGCTTTTTAAATCTTTATGTCAAATGGCTAGACCCTCGATTAATACTAGCAAACA
GCTGGTGTGACTTATGCAATTCCTTTGGTAAATTATGTGTTTCCTGATTTTAATAATAAC
TCATAGTTAAAATAAACTCCTTTAAATATTATCAAATGCTCAGATGTTTCCTTAAATGGA
TTTTATTGCTTTGATTTTACTCCTATAAGTAACAATTAGAATCAAATGAATATAGGTTTT
GATAAAAATTAAATTGGAAACTACAGATTTGAAATTAGCATCGCTTTATGTAACACTTAG
CAGTTTATTTCTACTTATAATTGTGCAAATACTGCATAAATTTAAAGCGATTTTTTAAAA
ATAACAAATAAACTAACGCTAAAATTGACCACATAGAAATACAACACACAAACATAGCTT
TATTAACAATTTACTAAAAAGGAACAAATATCAATCCAAGATACTTTAACAAATATTTTA
AAAATTAATTTTTTAAAAACAAATTCTACCATCTAGTAGGGTTTTATTACTTAAAATAAT
CAATATCAAAATTATATATCTGATTATAATAAAGAAAATCTATACTTTACCTAATCTGCA
GTTTAGTAGCAAAACAAAAACAATTTGAATTTGGTATCAATAATACAAATTTAAATTGGC
AGCTATGAGTTAAAATAGAATATTCAATACCCATAATTCACATACATTCTTGCTTAATTT
ATGAGTGCATTTAATGTTATACTTGTTCTTGGAATTATTGCCTAAATTTCAGCTCAAAGC
GAAATTATTTAAGACTTTGCAGAAATTTAATTTAAGTTTAACTTTAAGCACAATGCATGG
AAATATTTAATATCTAAAAATGAGGGTAAAATTTAAGATGCATCCTTATCATAAAATTTA
ACAAAATTGCATTTTTAAATTTAAAATCTATCATTTAGGCAATATTTAGATAAATATTTA
AATTTAAGCTTCTTTAAAAGGTAAAAATTAATTGCTTTATTTCTACTTTTATTATTAAAC
CTAATTGAATTTTTCAAATTTATTTATAAAAAATTAGGACAAAGCTATTATTAATGAATA
AATTATTTGATAAAGGAGTTACTAAAAATCCATAAGAAAAGGTATTCTAAAAATTAATAG
AGCAAGCTTCATAGCAGTTTAGTATTGTTGATCTTTAAAAAGAGTTAATGTAAATGAAAA
TAATTTTAAAATTACTTCTCTCACCTGAATAATATGCAGCTATTCAATTATGTGGTTACT
TATTTAAAAATGAAAATCAAGATTTCAATCATGATTAATCAAATTAAAGATTAACAAACA
ATGAAAAGTAAAATTAATGTAATCATTTGAAACAAGACATAAAATAACAACAATAATAAT
AAGACAAGATAGTAAAAGAGTTACTAAGTTAGGAAGATATCAAAAATGAGCTGGTTAAAC
TGAAAGCTATTTAATAGCCGTAAGTTTAATTCGAGAATAAAGAAAAATAAGATTAAAAAT
CTTTATCAAAATAAGAAAATGGGTTTATATCAAACTAAATTATATAAGAAGACATTTTAA
ATGAAAGAAAAGAAATTAATTAAATAGAAAGTAATAAACTTTCTTTAAAGCTGCAAGATA
AAGTTTATAAGAATAGTATCATTTATAAATAGAAGCAGGAATCACAAATCACTGATGATT
ATAATATCAATATCGATGATAATAAAATTGAATAGAGAAGTGAAAGTAGAATTGATAATC
ACTTAGAAATTATTGAATAGATAAATAATAATATGGAATAATTCTAAATATTCATCGAAA
AGTTTTTAGATCAAAGAAACACAAAATCTGAAATAGATAAGAGAATTTTAAGTTGTATGG
CAGGTATCCATAACTAAATTATAAATAAGCACCAATTGTTTTGA