Identifiers and Description

Gene Model Identifier

TTHERM_00418260

Standard Name

CTH114 (CaTHepsin 114)

Aliases

PreTt13595 | 45.m00240 | 3833.m00788

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR00898 ) cation transport protein
  • ( PF00112 ) Papain family cysteine protease
  • ( PF07695 ) 7TM diverse intracellular signalling
  • ( PF07690 ) transporter, major facilitator family
  • ( PF00083 ) transporter, major facilitator superfamily
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 20.6%

TetraMine Data

TTHERM_00418260

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05957.19.997093137033517e-262papain family cysteine proteas
e containing protein (510 aa)
OxytrichaContig19847.0.g770.000004000864880866421Major Facilitator Superfamily
WormBaseWBGene000223480.0002999184360822198status:Partially_confirmed U
niProt:Q9BKR9 protein_id:CCD
73048.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00418260(coding)
ATGCACGGCTCTAGCTCAACTAAAACACCAATCATTAAAAATGTCCCTAAGCTTTATTAC
TTAAAATTTTTATTACTTGCATTAGGATATGGATTTAATGGAACTACTTTTACAGGAATC
CCATTCTTATTTTATAGAGGAAAAATGAATTGTATAGATGCGAATAATAATTTATATTCA
TGCTCGACTGAATAAGCCTGTGCTAATCCATATGGGTTTGTAGAATAAACAGAATACCCT
TAAATTGGAAGTATTGTTTCTTTGCTTGATTTATACTGCGAGCGAAGAGTATTGGAAGCC
TGGATTCAAACCCTTGGTCAGTTTGGAAAGCTCATAGCTTATGTGATTCTTATCTTTTTT
CCAGTTAAAAAATAAATAAAAGAATATGTGATATTTGGAAGCTTCATTATAGTTGGACTA
GTACTAATGTCATTAGAATATCTTTAAGAAATTGAAATGTTTTTCATAGCTTTTTTTACC
TGGTATCTACTCTTTTCTGTCTTTTATGGATTAATCTACACTCACATTACAGATGTCTAT
CCTTATATTATCTCAGAGAATGGCTCAGCATATATTAACACTTCTTGGCCTGGAATTATG
ATAGTCTTTATCGCATATAGTTATTTCTTCGGTACCTGGGAAAATATTCTAATTTAATTC
ACTGGAATTCCACTTTTTTTAATTGGAGTTAGCAGCTTTGCTCTTAAATTTTACATGGAA
AGAAATAGTGAATACATTAATTTTGCTGAATAAGTATAGGAAGAGTAGAAATAACTCTAG
TCATAGTAAGAAATTCCTGTAGAGATAAATTAATCCACAATGGAGAAGCTCAAAGAAAAT
TATTAAGATGTCAAGAATAATAAATAATTAAGAGACAACTTGATGATATGGTCGTTAGGT
TGGACATGTAATGGTTTATGCTATTTTGGATGCTATTTCTAATTAAATACATTACAAGGT
AATTTGTATTTAAATAACCTTATGTCAACATTGTTCGAAGTATTAGCAAGTGTGATGGCT
GTAATTATTGTAATGAGAATGAATCTCAAAAATGTTATAGTCACTACATACTTTATAATA
GGATTCTCATTTACATCTTGTATATTTGTTAGTAATGACTTTAGCTAAAATCCTTCATTT
TCGTCTCTTATCATCAACTTATCTCCTGTAGTTATAGCTAAAGTTAGTTATGAAATAATG
TGGACTGTTTTAATTAAATACTAAAATACAGTCTTTGCAACAAAATATCATTAAATTTAA
TTTTCTTTCTCTAATATGGTAGCTATGATTGCCTGTAATGCTATACCTTTCTACAAATAT
TTTATGGAGTAGTTGAATTTAAGTCCTTTCATAGGTTACGGTCTATTTTGTTTAGCTGCT
TCTTATTTCTCTACTTAATTTATTGAAATTTAAAGTGGTAGTTAACAAGAACCTCTTAAA
GAACCACTAAAAAAAGAAGAATTTTAAAACATTGAATTAGATGAAATATATGAAATGGAT
TAAAAGTTATCTAAAATTTAGATATGA


>TTHERM_00418260(protein)
MHGSSSTKTPIIKNVPKLYYLKFLLLALGYGFNGTTFTGIPFLFYRGKMNCIDANNNLYS
CSTEQACANPYGFVEQTEYPQIGSIVSLLDLYCERRVLEAWIQTLGQFGKLIAYVILIFF
PVKKQIKEYVIFGSFIIVGLVLMSLEYLQEIEMFFIAFFTWYLLFSVFYGLIYTHITDVY
PYIISENGSAYINTSWPGIMIVFIAYSYFFGTWENILIQFTGIPLFLIGVSSFALKFYME
RNSEYINFAEQVQEEQKQLQSQQEIPVEINQSTMEKLKENYQDVKNNKQLRDNLMIWSLG
WTCNGLCYFGCYFQLNTLQGNLYLNNLMSTLFEVLASVMAVIIVMRMNLKNVIVTTYFII
GFSFTSCIFVSNDFSQNPSFSSLIINLSPVVIAKVSYEIMWTVLIKYQNTVFATKYHQIQ
FSFSNMVAMIACNAIPFYKYFMEQLNLSPFIGYGLFCLAASYFSTQFIEIQSGSQQEPLK
EPLKKEEFQNIELDEIYEMDQKLSKIQI


>TTHERM_00418260(gene)
ATGCACGGCTCTAGCTCAACTAAAACACCAATCATTAAAAATGTCCCTAAGCTTTATTAC
TTAAAATTTTTATTACTTGCATTAGGATATGGATTTAATGGAACTACTTTTACAGGAATC
CCATTCTTATTTTATAGAGGAAAAATGAATTGTATAGATGCGAATAATAATTTATATTCA
TGCTCGACTGAATAAGCCTGTGCTAATCCATATGGGTTTGTAGAATAAACAGAATACCCT
TAAATTGGAAGTATTGTTTCTTTGCTTGATTTATACTGCGAGCGAAGAGTATTGGAAGCC
TGGATTCAAACCCTTGGTCAGTTTGGAAAGCTCATAGCTTATGTGATTCTTATCTTTTTT
CCAGTTAAAAAATAAATAAAAGGTAATTAGTTAGTTAATTATTAATTTGTAAATTTTAAA
GTATTACATAAAAATTTGTGACAATTACTCAGAAAGTTAAATATATTTGATATAAATATG
AATACAACCGACTAGACCCAAATTTTTTTTGAAAATTATATAAAATGTAGTTTATTACTA
TATTAAATAGTGAAGTATTAATAATAATTACAAAATTACTAAACAGAAAACTTCTAAATT
TACCATTTGTATTAAATAAATAAAAGAAATAAATAAATAAATATTTTCCATTCTTCATTA
ACATTTCATAAAGCTTATTTACTTTATTTAAGAAGTGGATACTCTATTTCAATTTTACCA
TACTTTTATAATTTAACTTATTTTAATGTAAATTTAAATAATTAGAATATGTGATATTTG
GAAGCTTCATTATAGTTGGACTAGTACTAATGTCATTAGAATATCTTTAAGAAATTGAAA
TGTTTTTCATAGCTTTTTTTACCTGGTATCTACTCTTTTCTGTCTTTTATGGATTAATCT
ACACTCACATTACAGATGTCTATCCTTATATTATCTCAGAGAATGGCTCAGCATATATTA
ACACTTCTTGGCCTGGAATTATGATAGTCTTTATCGCATATAGTTATTTCTTCGGTACCT
GGGAAAATATTCTAATTTAATTCACTGGAATTCCACTTTTTTTAATTGGAGTTAGCAGCT
TTGCTCTTAAATTTTACATGGAAAGAAATAGTGAATACATTAATTTTGCTGAATAAGTAT
AGGAAGAGTAGAAATAACTCTAGTCATAGTAAGAAATTCCTGTAGAGATAAATTAATCCA
CAATGGAGAAGCTCAAAGAAAATTATTAAGATGTCAAGAATAATAAATAATTAAGAGACA
ACTTGATGATATGGTCGTTAGGTTGGACATGTAATGGTTTATGCTATTTTGGATGCTATT
TCTAATTAAATACATTACAAGGTAATTTGTATTTAAATAACCTTATGTCAACATTGTTCG
AAGTATTAGCAAGTGTGATGGCTGTAATTATTGTAATGAGAATGAATCTCAAAAATGTTA
TAGTCACTACATACTTTATAATAGGATTCTCATTTACATCTTGTATATTTGTTAGTAATG
ACTTTAGCTAAAATCCTTCATTTTCGTCTCTTATCATCAACTTATCTCCTGTAGTTATAG
CTAAAGTTAGTTATGAAATAATGTGGACTGTTTTAATTAAATACTAAAATACAGTCTTTG
CAACAAAATATCATTAAATTTAATTTTCTTTCTCTAATATGGTAGCTATGATTGCCTGTA
ATGCTATACCTTTCTACAAATATTTTATGGAGTAGTTGAATTTAAGTCCTTTCATAGGTT
ACGGTCTATTTTGTTTAGCTGCTTCTTATTTCTCTACTTAATTTATTGAAATTTAAAGTG
GTAGTTAACAAGAACCTCTTAAAGAACCACTAAAAAAAGAAGAATTTTAAAACATTGAAT
TAGATGAAATATATGAAATGGATTAAAAGTTATCTAAAATTTAGATATGA