Identifiers and Description

Gene Model Identifier

TTHERM_00268060

Standard Name

CTH110 (cathepsin 110)

Aliases

PreTt09841 | 24.m00272 | 3690.m00086

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08194 ) DIM protein
  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 77.7%

TetraMine Data

TTHERM_00268060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06873.19.997093137033517e-262papain family cysteine proteas
e containing protein (320 aa)
WormBaseWBGene000007763.000235161122315e-61locus:cpl-1 status:Confirmed
UniProt:O45734 protein_id
:CAB07275.1
OxytrichaContig16089.0.g25.9995872346509964e-61Papain family cysteine proteas
e
DictyBaseDDB_G02728152.0007467515522948e-59cprE on chromosome: 2 position
2212329 to 2213613
Stentor CoeruleusSteCoe_50443.6251409191435593e-34

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00268060(coding)
ATGAACAAATACTTATTACTCGCTTTAGCTGGTACCATCCTCTTAGGTGCTACTGCTTTC
TTAGTTGCTAAGAAGCACTCCGCTGTCTCTGATATTAAGATCGATGAAGACGTTTACACT
TAATGGAAGATCTTCAAGAAGACTTTCGGTAAGAAGTTCGCTGATCCCGACTAAGAACAC
TACAGAATTGAAGTCTTCGCTGCAAACCTCGAAACCATTAAGAATGATAAGACTGGTACT
TTGGGTATCACTCAATTCGCTGATCTCTCTCAAGAAGAATTCAAGAGCATCTATCTTACC
TTGTAAGTTGAATCTTCTGATGTTGAAACTGCTGAATACGAAGTTGCTGCTGATGATGTT
TCAATCAACTGGGTTACTGCTGGTAAGGTCACCGGTGTTAAGAACTAAGGTCAATGTGGT
TCCTGTTGGGCTTTCTCTACCACTGGTTCTTTCGAATCTGCTCTCATCCTCGCTAACAAG
GCTGACAACACCCTCAACCTTTCTGAATAACAATTGGTTGACTGCTCCATTTTGAACAAC
GGTTGCAACGGTGGTTTAATGGACAGAGCTTTCACTTACATCAAGAACCACAAGCTTGGT
ACTGAAGCTGCTTATCCTTACTTAGCTAAGAAGGGTAAATGCCAAAAGGTTACTGGTACT
TAATACTCTCTTAAGAGCTTCACTGATGTTAAGAAGGGTGACACTCAAGATCTCTTAAAT
TCTCTCCAAAAGCAACCCGTTTCTATTGCTGTTGATGCTTCTAACTGGTCTTTATACACT
GGTGGTGTCTTCTCTAACTGTTCTACCGGTCTTAACCACGGTGTCCTCCTCGTTGGTTAT
GAAAACAACGCTTGGATCGTTAAGAACTCCTGGGGTACCACCTGGGGTGAATAAGGTTAC
ATTAGACTTGCTAGCGGAAACACTTGCGGTCTTGCTAACGCTGCTTCTTATCCCAACGTT
TGA


>TTHERM_00268060(protein)
MNKYLLLALAGTILLGATAFLVAKKHSAVSDIKIDEDVYTQWKIFKKTFGKKFADPDQEH
YRIEVFAANLETIKNDKTGTLGITQFADLSQEEFKSIYLTLQVESSDVETAEYEVAADDV
SINWVTAGKVTGVKNQGQCGSCWAFSTTGSFESALILANKADNTLNLSEQQLVDCSILNN
GCNGGLMDRAFTYIKNHKLGTEAAYPYLAKKGKCQKVTGTQYSLKSFTDVKKGDTQDLLN
SLQKQPVSIAVDASNWSLYTGGVFSNCSTGLNHGVLLVGYENNAWIVKNSWGTTWGEQGY
IRLASGNTCGLANAASYPNV


>TTHERM_00268060(gene)
ATGAACAAATACTTATTACTCGCTTTAGCTGGTACCATCCTCTTAGGTGCTACTGCTTTC
TTAGTTGCTAAGAAGCACTCCGCTGTCTCTGATATTAAGATCGATGAAGACGTTTACACT
TAATGGAAGATCTTCAAGAAGACTTTCGGTAAGAAGTTCGCTGATCCCGACTAAGAACAC
TACAGAATTGAAGTCTTCGCTGCAAACCTCGAAACCATTAAGAATGATAAGACTGGTACT
TTGGGTATCACTCAATTCGCTGATCTCTCTCAAGAAGAATTCAAGAGCATCTATCTTACC
TTGTAAGTTGAATCTTCTGATGTTGAAACTGCTGAATACGAAGTTGCTGCTGATGATGTT
TCAATCAACTGGGTTACTGCTGGTAAGGTCACCGGTGTTAAGAACTAAGGTCAATGTGGT
TCCTGTTGGGCTTTCTCTACCACTGGTTCTTTCGAATCTGCTCTCATCCTCGCTAACAAG
GCTGACAACACCCTCAACCTTTCTGAATAACAATTGGTTGACTGCTCCATTTTGAACAAC
GGTTGCAACGGTGGTTTAATGGACAGAGCTTTCACTTACATCAAGAACCACAAGCTTGGT
ACTGAAGCTGCTTATCCTTACTTAGCTAAGAAGGGTAAATGCCAAAAGGTTACTGGTACT
TAATACTCTCTTAAGAGCTTCACTGATGTTAAGAAGGGTGACACTCAAGATCTCTTAAAT
TCTCTCCAAAAGCAACCCGTTTCTATTGCTGTTGATGCTTCTAACTGGTCTTTATACACT
GGTGGTGTCTTCTCTAACTGTTCTACCGGTCTTAACCACGGTGTCCTCCTCGTTGGTTAT
GAAAACAACGCTTGGATCGTTAAGAACTCCTGGGGTACCACCTGGGGTGAATAAGGTTAC
ATTAGACTTGCTAGCGGAAACACTTGCGGTCTTGCTAACGCTGCTTCTTATCCCAACGTT
TGA