Identifiers and Description

Gene Model Identifier

TTHERM_00802340

Standard Name

CTH104 (CaTHepsin 104)

Aliases

PreTt22705 | 136.m00075 | 3808.m00363

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 34.5%

TetraMine Data

TTHERM_00802340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13588.12.9990501533945683e-168papain family cysteine proteas
e containing protein (326 aa)
DictyBaseDDB_G02728158.001227934218267e-54cprE on chromosome: 2 position
2212329 to 2213613
OxytrichaContig322.1.g1167.002411919958887e-50Papain family cysteine proteas
e
WormBaseWBGene000070552.000704504372864e-47locus:tag-196 status:Confirm
ed UniProt:O16454 protein_
id:CCD64084.1
Stentor CoeruleusSteCoe_50442.3802664086944007e-26

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00802340(coding)
ATGAAGACTTAATTGCTTATCGCTGCTACTTTGGGTTTAACCTTATTAGGTTTAACTTCA
TTTTTACTTATCCACAAATCCTCTAGAGTAGAATTTACTGAAGACCAAATTAAAATGTGG
AAGAGTTTCAAGTAAACTTATAACAAGAAATATGCTGATTAAGATGATGATGAAGAAGTT
TACAGAATGAATGTCTTCTTTGATAATTTGGAATTCACTAAAAAAGATCCAACTATGGGT
GTTACTAAATTTATGGATCTTACTCATACAGAATTCGCAGAACTCTACTTGAATCCTGCT
GAAAACATTGATGAAGAAATCGACTCTTTATAACCAATTTAACATAATGAAGATATTGTT
ATTGATTGGGTTGAAAAAGGTGCAGTTACTCCTGTTAAAAATTAAGGAGGTTGTGGTGGC
TGTTGGTCATTTGCTACAACTGGTGGTGTTGAGGGTGCTAACTTCGTCTACAAAAATGTC
CTCCCTAATTTATCTTAACAATAATTGATTGATTGCAACACTTAAAATAAGGGTTGTGGT
GGCGGCTTAAGAGATATTGCCTTAAATTATGTAAAAGAAACAGGTTTAACTACAGAAGAA
GAGTATTCATATGAAGCCAAAAATGGTAAATGCAGACTTTAAGGTAAGAGCAATCCTTAT
ACTATTTCTGGTTTCACAGCTATTAAGTAATGTTCTGACCTAGTAAATGCTATTCAAAAA
GCTCCCGTTACTGTTGGTATTGATTCTTCTAACCTCTAATTCTATACAAACGGAATCTTC
TCAAACTGTGGTACGAAGATCAATCACGGAGTTCTGCTTGTTGGTTATGATTCTGTCAAA
GAAGCTTGGAAGGTAAAAAACTCATGGGGTCCTAAATTTGGTGAAGGTGGTTACATCTAT
CTCTCTGCTAAGATTACTAATAATCAAATTGCTAACACTTGTGCTATTTGTACTAGAGCT
TATGCACCTTACATTTGA


>TTHERM_00802340(protein)
MKTQLLIAATLGLTLLGLTSFLLIHKSSRVEFTEDQIKMWKSFKQTYNKKYADQDDDEEV
YRMNVFFDNLEFTKKDPTMGVTKFMDLTHTEFAELYLNPAENIDEEIDSLQPIQHNEDIV
IDWVEKGAVTPVKNQGGCGGCWSFATTGGVEGANFVYKNVLPNLSQQQLIDCNTQNKGCG
GGLRDIALNYVKETGLTTEEEYSYEAKNGKCRLQGKSNPYTISGFTAIKQCSDLVNAIQK
APVTVGIDSSNLQFYTNGIFSNCGTKINHGVLLVGYDSVKEAWKVKNSWGPKFGEGGYIY
LSAKITNNQIANTCAICTRAYAPYI


>TTHERM_00802340(gene)
ATGAAGACTTAATTGCTTATCGCTGCTACTTTGGGTTTAACCTTATTAGGTTTAACTTCA
TTTTTACTTATCCACAAATCCTCTAGAGTAGAATTTACTGAAGACCAAATTAAAATGTGG
AAGAGTTTCAAGTAAACTTATAACAAGAAATATGCTGATTAAGATGATGATGAAGAAGTT
TACAGAATGAATGTCTTCTTTGATAATTTGGAATTCACTAAAAAAGATCCAACTATGGGT
GTTACTAAATTTATGGATCTTACTCATACAGAATTCGCAGAACTCTACTTGAATCCTGCT
GAAAACATTGATGAAGAAATCGACTCTTTATAACCAATTTAACATAATGAAGATATTGTT
ATTGATTGGGTTGAAAAAGGTGCAGTTACTCCTGTTAAAAATTAAGGAGGTTGTGGTGGC
TGTTGGTCATTTGCTACAACTGGTGGTGTTGAGGGTGCTAACTTCGTCTACAAAAATGTC
CTCCCTAATTTATCTTAACAATAATTGATTGATTGCAACACTTAAAATAAGGGTTGTGGT
GGCGGCTTAAGAGATATTGCCTTAAATTATGTAAAAGAAACAGGTTTAACTACAGAAGAA
GAGTATTCATATGAAGCCAAAAATGGTAAATGCAGACTTTAAGGTAAGAGCAATCCTTAT
ACTATTTCTGGTTTCACAGCTATTAAGTAATGTTCTGACCTAGTAAATGCTATTCAAAAA
GCTCCCGTTACTGTTGGTATTGATTCTTCTAACCTCTAATTCTATACAAACGGAATCTTC
TCAAACTGTGGTACGAAGATCAATCACGGAGTTCTGCTTGTTGGTTATGATTCTGTCAAA
GAAGCTTGGAAGGTAAAAAACTCATGGGGTCCTAAATTTGGTGAAGGTGGTTACATCTAT
CTCTCTGCTAAGATTACTAATAATCAAATTGCTAACACTTGTGCTATTTGTACTAGAGCT
TATGCACCTTACATTTGA