Identifiers and Description

Gene Model Identifier

TTHERM_00879300

Standard Name

CTH101 (cathepsin 101)

Aliases

PreTt09728 | 156.m00112

Description

Papain family cysteine protease containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00879300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13352.18.997677048217667e-123papain family cysteine proteas
e containing protein (333 aa)
OxytrichaContig322.1.g1169.001802505664736e-52Papain family cysteine proteas
e
DictyBaseDDB_G02722988.999409812021828e-43DDB_G0272298 on chromosome: 2
position 1664020 to 1665049
WormBaseWBGene000070553.001129784945559e-41locus:tag-196 status:Confirm
ed UniProt:O16454 protein_
id:CCD64084.1
Stentor CoeruleusSteCoe_149226.47023492564546e-26

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00879300(coding)
ATGAATAAATTGATCCTTTTGAGTATTATCATGCTCATGCCTCTCTGCTTGGCTCAAAAT
ATAAACGTAGAAAAACTTCTTGCTTATAATTAATGGTCAAGCTAAAATCAAAGGGTTTAT
CTGAATGAACATGAAAAACTATTTAGACAAATGGTTTTCTTTGAGAACTTTTAAAAGATT
TAGGAACATAACAGTGATCCTAATAACACCTATTCTGTCCATTTAAACTAATTCTCAGAT
ATGACTAAAGAAGAATTTGCTGAAAAAATTCTTATGAAATCTGATTTGGTTGACCATTTA
ATGAAAGGAATCAGTTAAGAGGCAACTCATAATGATACTAATAATAACGAAACTTAATTG
AGTTCAAATAGCCTTACTTTAGCTGATTCAATAGACTGGAGAACAAAAGGTGCTGTAACA
TCAGTTAAGAATTAAGGTGGTTGTGGTTCATGCTGGAGTTTCTCTGCAGCTGCAGTAATG
GAGTCATTTAACTTCATTTAAAACAAAGCTTTAGTTGATTTTTCTGAGTAATAACTTGTT
GACTGTGTCATCCCTGCAAATGGTTACAACTCTTATGGATGTAATGGAGGATGGCCTGTT
TAATGTCTGGATTATGCCTCCAAAGTAGGTATTACTACCCTAGACAAGTATCCCTATGTT
GCAGTTTAGAAAAATTGTAATGTGACTGGCACAGATAATGGCTTTAAGCCTAAAAGCTGG
ATTTAAATTCCTAACACTTCTAATGACTTAAAAAGTGCTTTGAATTTTTCTCCTGTTTCT
GTTCTTGTTGATGCTTCCACTTGGGGTAATTATTATTCTGGAATTTTCAACGGATGTGAT
TAAACTCATATTAGCCTTAATCATGCTGTATTAGCTGTTGGCTATGACTAACAAGGAAAC
TGGATTATTAAAAATTCTTGGAGTACTTATTGGGGTGAAAATGGCTTTATGAGACTTGCT
CCTAACAACACATGCGGTATCTTAAGCTATAATCTTTAAGTTACTGCTTGA


>TTHERM_00879300(protein)
MNKLILLSIIMLMPLCLAQNINVEKLLAYNQWSSQNQRVYLNEHEKLFRQMVFFENFQKI
QEHNSDPNNTYSVHLNQFSDMTKEEFAEKILMKSDLVDHLMKGISQEATHNDTNNNETQL
SSNSLTLADSIDWRTKGAVTSVKNQGGCGSCWSFSAAAVMESFNFIQNKALVDFSEQQLV
DCVIPANGYNSYGCNGGWPVQCLDYASKVGITTLDKYPYVAVQKNCNVTGTDNGFKPKSW
IQIPNTSNDLKSALNFSPVSVLVDASTWGNYYSGIFNGCDQTHISLNHAVLAVGYDQQGN
WIIKNSWSTYWGENGFMRLAPNNTCGILSYNLQVTA


>TTHERM_00879300(gene)
ATGAATAAATTGATCCTTTTGAGTATTATCATGCTCATGCCTCTCTGCTTGGCTCAAAAT
ATAAACGTAGAAAAACTTCTTGCTTATAATTAATGGTCAAGCTAAAATCAAAGGGTTTAT
CTGAATGAACATGAAAAACTATTTAGACAAATGGTTTTCTTTGAGAACTTTTAAAAGATT
TAGGAACATAACAGTGATCCTAATAACACCTATTCTGTCCATTTAAACTAATTCTCAGAT
ATGACTAAAGAAGAATTTGCTGAAAAAATTCTTATGAAATCTGATTTGGTTGACCATTTA
ATGAAAGGAATCAGTTAAGAGGCAACTCATAATGATACTAATAATAACGAAACTTAATTG
AGTTCAAATAGCCTTACTTTAGCTGATTCAATAGACTGGAGAACAAAAGGTGCTGTAACA
TCAGTTAAGAATTAAGGTGGTTGTGGTTCATGCTGGAGTTTCTCTGCAGCTGCAGTAATG
GAGTCATTTAACTTCATTTAAAACAAAGCTTTAGTTGATTTTTCTGAGTAATAACTTGTT
GACTGTGTCATCCCTGCAAATGGTTACAACTCTTATGGATGTAATGGAGGATGGCCTGTT
TAATGTCTGGATTATGCCTCCAAAGTAGGTATTACTACCCTAGACAAGTATCCCTATGTT
GCAGTTTAGAAAAATTGTAATGTGACTGGCACAGATAATGGCTTTAAGCCTAAAAGCTGG
ATTTAAATTCCTAACACTTCTAATGACTTAAAAAGTGCTTTGAATTTTTCTCCTGTTTCT
GTTCTTGTTGATGCTTCCACTTGGGGTAATTATTATTCTGGAATTTTCAACGGATGTGAT
TAAACTCATATTAGCCTTAATCATGCTGTATTAGCTGTTGGCTATGACTAACAAGGAAAC
TGGATTATTAAAAATTCTTGGAGTACTTATTGGGGTGAAAATGGCTTTATGAGACTTGCT
CCTAACAACACATGCGGTATCTTAAGCTATAATCTTTAAGTTACTGCTTGA