Identifiers and Description

Gene Model Identifier

TTHERM_00052190

Standard Name

CTH1 (CaTHepsin 1 (Cathepsin D))

Aliases

PreTt11399 | 3.m01858 | 3824.m03154

Description

CTH1 eukaryotic aspartyl protease

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 47.6%

TetraMine Data

TTHERM_00052190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01548.19.997093137033517e-262eukaryotic aspartyl protease (
460 aa)
DictyBaseDDB_G02794119.996696112986116e-50ctsD on chromosome: 3 position
2104523 to 2105867
WormBaseWBGene000002173.998777993244535e-41locus:asp-4 status:Confirmed
UniProt:Q21966 protein_id
:CAA90633.1
OxytrichaContig18588.0.g1101.999002769139511e-37Eukaryotic aspartyl protease
SGDYPL154C9.997975313387782e-28PEP4 Vacuolar aspartyl proteas
e (proteinase A), required for
the posttranslational precurs
or maturation of vacuolar prot
einases; important for protein
turnover after oxidative dama
ge; synthesized as a zymogen,
self-activates
Stentor CoeruleusSteCoe_117152.3802664086944007e-26

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00052190(coding)
ATGATTAAGTTCAAGAATAAATTAAACTTTGTATTGATTGGTTTGATTCTCATTTTTTAT
TTGATTGGAATTGTAGAATCAAAAAATAACAATGGGAAGCATAAAACTCAAAAATCTTTC
ATTTAGTAGAAGAATGTCTTAAAAAAAAAAATTTACTCAATTCCTTTAACTAAAAAGCTT
CCCTCATAAGAATATCAAATCGAGACTCTAAATATTTTGAAAGAGCATCAAGCTTTACTT
TTGTAAATGAAAACATTTTCTTATTTAGAAATGGATTCTAATAAGCAAATAGTAAAAAAA
TAAAAGCAATTCAACAGTTTTTTGCAAACAGATTTGAAAATGCTAAAATAAAAGCAATCT
TTAGAGCTTAGAAATAGAGATAATTCTTTTTTTACTGGAAGAATAGAAGTAGGAAAATAG
CCTTTTGATGTTATTTTCGATACTGGAAGTGCTTTTGTTTTTATAAATAGCGACTATTGT
GCAGAATGCATGCAAGATCATCACTATTACACTGAAACAAAAACTTTGGAAGAAACTAAT
TTAGACATCACTGTTTAATTTGGTACTGGTTAGTTATCAGGTCTTTTAAGCAAAGATATA
ATAAGTCTAGGAGAAATAGAATTAGAAAAAGGTGTTTTCGCATAGATTACTTAGCAAGAT
GGAAGCTTATTTAAATCTCATTTTGATGGTATTGTTGGTTTATCTGCCCTAGATTTATCT
GAAGAATCCCCTTCTTTACTATCATAATTAAATAATTCTGGACAACTAGAACATAATGTA
GTTTCATTCTTCTTAGAAAGAGACGAAACTGGTTCTTAAATAATTCTAGGAGGAGTAGAC
AAAGACAAATATGATGGTGAAATTTAGTACCATCCAAGAATTGATGAGACTAATTTTTGG
ACTCTCCCTTGCAAATAAATTAAGGTTGGTAATGAGGATACAGGTTTATGCTCTGAAAGC
AACATTTGCAGATTAATTGTAGACTCTGGTACTTCTTTGTTCACTGGTCCTCATGATTCA
GTTGCAGTTCTCTTGAATAAGTTAAATAAAAATGAAGAAGGTTGTAAAAATTTGTATGAT
TTGCCTACAATTACCTTTGTTGTTGAAGACTCTGAATACACAGTTTATCCTAATGAATAC
ATAATAACTTCTACAATCACCCATAGCGATCCTTTTTATGAGCATTCAGATATTGATATA
ATAGTTGAGTGCATGGTTTCATTTTATGGGCTTTAAGTTAATGATCAAGGAGAAAGTTAA
AATACTTGGATTCTTGGAGATGTTTTTATGGGTAAATATTATACTGTTTTTGATAGTGAA
AATAAAAGAATAGGATTAGCTAAATCTATAAACTATGCATCTTATATTCACTGA


>TTHERM_00052190(protein)
MIKFKNKLNFVLIGLILIFYLIGIVESKNNNGKHKTQKSFIQQKNVLKKKIYSIPLTKKL
PSQEYQIETLNILKEHQALLLQMKTFSYLEMDSNKQIVKKQKQFNSFLQTDLKMLKQKQS
LELRNRDNSFFTGRIEVGKQPFDVIFDTGSAFVFINSDYCAECMQDHHYYTETKTLEETN
LDITVQFGTGQLSGLLSKDIISLGEIELEKGVFAQITQQDGSLFKSHFDGIVGLSALDLS
EESPSLLSQLNNSGQLEHNVVSFFLERDETGSQIILGGVDKDKYDGEIQYHPRIDETNFW
TLPCKQIKVGNEDTGLCSESNICRLIVDSGTSLFTGPHDSVAVLLNKLNKNEEGCKNLYD
LPTITFVVEDSEYTVYPNEYIITSTITHSDPFYEHSDIDIIVECMVSFYGLQVNDQGESQ
NTWILGDVFMGKYYTVFDSENKRIGLAKSINYASYIH


>TTHERM_00052190(gene)
ATGATTAAGTTCAAGAATAAATTAAACTTTGTATTGATTGGTTTGATTCTCATTTTTTAT
TTGATTGGAATTGTAGAATCAAAAAATAACAATGGGAAGCATAAAACTCAAAAATCTTTC
ATTTAGTAGAAGAATGTCTTAAAAAAAAAAATTTACTCAATTCCTTTAACTAAAAAGCTT
CCCTCATAAGAATATCAAATCGAGACTCTAAATATTTTGAAAGAGCATCAAGCTTTACTT
TTGTAAATGAAAACATTTTCTTATTTAGAAATGGATTCTAATAAGCAAATAGTAAAAAAA
TAAAAGCAATTCAACAGTTTTTTGCAAACAGATTTGAAAATGCTAAAATAAAAGCAATCT
TTAGAGCTTAGAAATAGAGATAATTCTTTTTTTACTGGAAGAATAGAAGTAGGAAAATAG
CCTTTTGATGTTATTTTCGATACTGGAAGTGCTTTTGTTTTTATAAATAGCGACTATTGT
GCAGAATGCATGCAAGATCATCACTATTACACTGAAACAAAAACTTTGGAAGAAACTAAT
TTAGACATCACTGTTTAATTTGGTACTGGTTAGTTATCAGGTCTTTTAAGCAAAGATATA
ATAAGTCTAGGAGAAATAGAATTAGAAAAAGGTGTTTTCGCATAGATTACTTAGCAAGAT
GGAAGCTTATTTAAAGTAATACTTTAAAGTTTCAATACTAAATTTATGAATATTCAATTA
TTAAATATATTCAAAATATTTAGTTTTGTAATAAATTTTAAAAATATATAATTAGTCTCA
TTTTGATGGTATTGTTGGTTTATCTGCCCTAGATTTATCTGAAGAATCCCCTTCTTTACT
ATCATAATTAAATAATTCTGGACAACTAGAACATAATGTAGTTTCATTCTTCTTAGAAAG
AGACGAAACTGGTTCTTAAATAATTCTAGGAGGAGTAGACAAAGACAAATATGATGGTGA
AATTTAGTACCATCCAAGAATTGATGAGACTAATTTTTGGACTCTCCCTTGCAAATAAAT
TAAGGTTGGTAATGAGGATACAGGTTTATGCTCTGAAAGCAACATTTGCAGATTAATTGT
AGACTCTGGTACTTCTTTGTTCACTGGTCCTCATGATTCAGTTGCAGTTCTCTTGAGTAA
ATAAATTAATATATTTCTTTCTTTCTTATATTTATAATATTTTAATTTAGATAAGTTAAA
TAAAAATGAAGAAGGTTGTAAAAATTTGTATGATTTGCCTACAATTACGTAAACAATAAA
AATCAATTAAAATATTTAAATTAACCTCATTTTATGAAAAAAGCTTTGTTGTTGAAGACT
CTGAATACACAGTTTATCCTAATGAATACATAATAACTTCTACAATCACCCATAGCGATC
CTTTTTATGAGCATTCAGATATTGATATAATAGTTGAGTGCATGGTTTCATTTTATGGGC
TTTAAGTTAATGATCAAGGAGGTAATTATTTCATTTATTCTTTAAAAATTTTAAAATAAA
AACTAATTATTTATTAAATTAATTTCAATTTTTATTCTCTATTCTAATTTAGAAAGTTAA
AATACTTGGATTCTTGGAGATGTTTTTATGGGTAAATATTATACTGTTTTTGATAGTGAA
AATAAAAGAATAGGATTAGCTAAATCTATAAACTATGCATCTTATATTCACTGA