Identifiers and Description

Gene Model Identifier

TTHERM_00483610

Standard Name

CTF18 (Chromosome Transmission Fidelity)

Aliases

PreTt06295 | 58.m00267 | 3719.m00121

Description

ATPase, AAA family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07170 ) Sortase B
  • ( PF01202 ) shikimate kinase
  • ( PF00004 ) ATPase, AAA family
  • ( TIGR01351 ) adenylate kinases
  • ( PF01583 ) adenylylsulfate kinase
  • ( TIGR02173 ) cytidylate kinase, putative
  • ( PF08729 ) Histone promoter control 2 (HPC2)
  • ( PF00010 ) Helix-loop-helix DNA-binding domain
  • ( PF00005 ) ABC transporter, ATP-binding protein
  • ( PF02367 ) uncharacterised P-loop hydrolase UPF0079
  • ( PF03029 ) Conserved hypothetical ATP binding protein
  • ( TIGR02397 ) DNA polymerase III, subunit gamma
  • ( PF01656 ) CobQ/CobB/MinD/ParA nucleotide binding domain
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00483610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14237.19.997093137033517e-262ATPase, AAA family protein (84
2 aa)
OxytrichaContig21660.0.g934.997860539111522e-53Rad17 cell cycle checkpoint pr
otein
DictyBaseDDB_G02727581.0002335610448659e-38chtf18 on chromosome: 2 positi
on 2108163 to 2111066
WormBaseWBGene000106762.998800627344286e-26status:Confirmed UniProt:Q21
350 protein_id:CAA93081.1
SGDYMR078C9.000561397357242e-21CTF18 Subunit of a complex wit
h Ctf8p that shares some subun
its with Replication Factor C
and is required for sister chr
omatid cohesion; may have over
lapping functions with Rad24p
in the DNA damage replication
checkpoint

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00483610(coding)
ATGAGTTGGAAACATAACTATGATGATTATTTTGAAGGCATTAATATAGATGATAGGGAT
CTTCATTATTCATCTGATGATGCTAATGAATAGCTTAAAATTAACTTTTATATTTAGAAT
CCAAATGAGACAGAGGAAGAAGATAAAATTGTATCAACAATGAACTTCTACGTTTACAAG
AATAAAAGGGAAAAATATGATCCAAGTATAAATTAGAATATTATTAAACTATTTGAGAGA
CAAAGTTTGCTCATAACACCAATTGAAGAGTTAGAGTAAATAGTTTAGGAGTAAAGAAAA
GCAAAAGCTGCTCAAATTGAGTAGGAGCTGTAGTAGGAAATTATGGACGAAGATAAATAG
TTAATAAAGAGAGAAAATTTAAAAGATAGGTAATTGTGGGTGGATAAATATATGCCAAAG
AGATATGATGAACTTCTCAGTTTTGATAAAATTAATAGGGAGGTTATGTGCTGGTTAAAA
GCATGGGATCCTATTGTTTTTAAGAAAAAATTAAAAAAAAGCATCTTTTAGAATTAGTAT
AATAATTAATATAACAATTAGTATAATAACTAAAGTTATGGCAGAAATATTTTTGGCTAA
GTTTAAAAAGTCAACAACAGCAGCAGCGTTTACAATAATAATTTTAATAAGATTGGAGAT
GAAGCTAATAAAGGATTTTAAGCAGGAGATTAAAATAAATTCTTTTAAGGATAAGGAAAT
AATAAGTTTTAATACACTGGATAAAAGCCTTTTTATTTTGATTTAAGTGATGATTATTCA
GTATAAAAAATGTAAAACAGTGTTATTCTTCTTGCAGGACCTCCTGGTTCAGGTAAAACC
ACATTAGCAAGGACTGTTGCAAAGCATTGTGGATACAAAGTTATTGAAATAAATGCATCA
GAGGAAAGAACTGCAGCAAAGCTTATTGAAAAAATAGAAACAGTGACAAGAAATGAAGCT
TTGTAATTCAAAAACGATAATAAAGCTGAAGAATAAAAAGAAAAACCTTCTTTGATTATT
GTAGACGAAGTAGATGGAGCTATGGAATCTGAGAGTCATGGAGCTGTTAATCACTTACTA
GACTTCATTTTTAAAGGATAAAAGAATATACAAAAAAAGGGAGCTGGCGAAGCTCAAACA
AAATAAAGCAATTAAAAAAAGAAACCTGAGTCAAAAAAGAAAAAGAAAAAGGACGAAGAT
GATGAAGATGGAGATGAGGATAACTTGAATGAAGAAGATGATAAAGGTTTAGAAGAAGAA
ACAACAAAATAAACAGCATAAAACGTTCATATTAGAAGACCAGTTATCTTTATTTGTAAC
GATATTTACAGTAAAGGGTTAAGGGAACTTAGAAAAAAAGCCTTCGTATTTAATTTTACG
AAAGCAAGGAGCGATAAGCTAGTACAAAGACTGAGAGAAATCTGCCATAAAGAAAAGTTA
AGTATAGATTAATCAGGATTATAAAAGATATGTGACCACAATGAGAACGATATAAGATCT
ACATTAATGAACCTTTAAATGATATCAAAAATTCAAAAGCAAGACAATCGCTCTAAAATA
TCAATCGACTAAATTCTCATGGAAGAAAAAAACAACTCTAAAAGTATTTTAGAGCTCTTA
GAGTGCATCATGATGCCTCCAATCAATAAAAAGGACTCTAAAATTGATATTTTGAGATAC
ACTATACATACTCTAATTAAAAACACATAACCTGATTAACTGATAGAAGCAACACTTTTA
AACTATAGCAAAATAAAAAATACTGAGAGATTCTTTGATAAAATACCTTAGTTTTTGGAT
GATTTATCTTTGGCAGAAATTTTAGAAAGTAATTTGCTAAAACACAATTATGAAATGACA
AAGTTTATATCGCTTCCAATTATAAATTTTGGTCTCAATCTTAAAGGTTAAGAAAGAGTA
AAGCTAGACTTCCCTAGAGACAAATTCACTCTTAAAAAAAGATATAAAGCTGCCATGGAT
TGCATAGAAAGTTTACTAGAAAACCTTCCAAACTCAGATGCTCCTTACTTAAATAATAAG
AATTTCGTGCTAGATTATTTATCAAATATTTATTAAATAATACAGCCTAATATTTCATCT
AACATAATCAGTGACAGTGAAAAGAAAGACTTATACACTTCTTTGAGCATTATGATAGAC
TTCTCTTTGAAATTATTAGATAATCCCTTTAAAATAGATAGAAGCGGTCAAAAATTTAAT
ATATATTTTACTCCTTAAATAGAAAGATTGCTTTTATTTGGAAACGATGTACCCGTATAA
AGACTGAATGAGAGATCAATACACTTTATTTTAAAAAATTATGATATAATAAACCATTAA
AAAACACTGGCAAAAGATATGGCAGACGATGAAATACAGTAAAAGAAGCTTGAAGAAAAA
TTAATGAATATTGAAATGCTTGACAATTAATACAATAAAAAAGCTAACAAAAGAAAAAAA
AGAATAGAAGGAGAAGATGCTTCATTTTTATATAAATTTAGGGAAGGAGTTAGTATTCCT
ATAAAGTACGATGTAAAAATGTCATAGCTCTTCATGTGA


>TTHERM_00483610(protein)
MSWKHNYDDYFEGINIDDRDLHYSSDDANEQLKINFYIQNPNETEEEDKIVSTMNFYVYK
NKREKYDPSINQNIIKLFERQSLLITPIEELEQIVQEQRKAKAAQIEQELQQEIMDEDKQ
LIKRENLKDRQLWVDKYMPKRYDELLSFDKINREVMCWLKAWDPIVFKKKLKKSIFQNQY
NNQYNNQYNNQSYGRNIFGQVQKVNNSSSVYNNNFNKIGDEANKGFQAGDQNKFFQGQGN
NKFQYTGQKPFYFDLSDDYSVQKMQNSVILLAGPPGSGKTTLARTVAKHCGYKVIEINAS
EERTAAKLIEKIETVTRNEALQFKNDNKAEEQKEKPSLIIVDEVDGAMESESHGAVNHLL
DFIFKGQKNIQKKGAGEAQTKQSNQKKKPESKKKKKKDEDDEDGDEDNLNEEDDKGLEEE
TTKQTAQNVHIRRPVIFICNDIYSKGLRELRKKAFVFNFTKARSDKLVQRLREICHKEKL
SIDQSGLQKICDHNENDIRSTLMNLQMISKIQKQDNRSKISIDQILMEEKNNSKSILELL
ECIMMPPINKKDSKIDILRYTIHTLIKNTQPDQLIEATLLNYSKIKNTERFFDKIPQFLD
DLSLAEILESNLLKHNYEMTKFISLPIINFGLNLKGQERVKLDFPRDKFTLKKRYKAAMD
CIESLLENLPNSDAPYLNNKNFVLDYLSNIYQIIQPNISSNIISDSEKKDLYTSLSIMID
FSLKLLDNPFKIDRSGQKFNIYFTPQIERLLLFGNDVPVQRLNERSIHFILKNYDIINHQ
KTLAKDMADDEIQQKKLEEKLMNIEMLDNQYNKKANKRKKRIEGEDASFLYKFREGVSIP
IKYDVKMSQLFM


>TTHERM_00483610(gene)
ATGAGTTGGAAACATAACTATGATGATTATTTTGAAGGCATTAATATAGATGATAGGGAT
CTTCATTATTCATCTGATGATGCTAATGAATAGCTTAAAATTAACTTTTATATTTAGAAT
CCAAATGAGACAGAGGAAGAAGATAAAATTGTATCAACAATGAACTTCTACGTTTACAAG
AATAAAAGGGAAAAATATGATCCAAGTATAAATTAGAATATTATTAAACTATTTGAGAGA
CAAAGTTTGCTCATAACACCAATTGAAGAGTTAGAGTAAATAGTTTAGGAGTAAAGAAAA
GTAATTATTTTATTTTATTTTATTTTCACCTTTATTATTATTAAATGTTAATTGATATCA
ATTAAAAGGCAAAAGCTGCTCAAATTGAGTAGGAGCTGTAGTAGGAAATTATGGACGAAG
ATAAATAGTTAATAAAGAGAGAAAATTTAAAAGATAGGTAATTGTGGGTGGATAAATATA
TGCCAAAGAGATATGATGAACTTCTCAGTTTTGATAAAATTAATAGGGAGGTTATGTGCT
GGTTAAAAGCATGGGATCCTATTGTTTTTAAGAAAAAATTAAAAAAAAGCATCTTTTAGA
ATTAGTATAATAATTAATATAACAATTAGTATAATAACTAAAGTTATGGCAGAAATATTT
TTGGCTAAGTTTAAAAAGTCAACAACAGCAGCAGCGTTTACAATAATAATTTTAATAAGA
TTGGAGATGAAGCTAATAAAGGATTTTAAGCAGGAGATTAAAATAAATTCTTTTAAGGAT
AAGGAAATAATAAGTTTTAATACACTGGATAAAAGCCTTTTTATTTTGATTTAAGTGATG
ATTATTCAGTATAAAAAATGTAAAACAGTGTTATTCTTCTTGCAGGACCTCCTGGTTCAG
GTAAAACCACATTAGCAAGGACTGTTGCAAAGCATTGTGGATACAAAGTTATTGAAGTAA
ATTCTTAAAAACTCTAAATATTTTTATATTAATTATTTTTTAATTATTAATGAAAGATAA
ATGCATCAGAGGAAAGAACTGCAGCAAAGCTTATTGAAAAAATAGAAACAGTGACAAGAA
ATGAAGCTTTGTAATTCAAAAACGATAATAAAGCTGAAGAATAAAAAGAAAAACCTTCTT
TGATTATTGTAGACGAAGTAGATGGAGCTATGGAATCTGAGAGTCATGTAAAAAGTTTTT
CTATTAATTAAATACAAAATTTGACTTCTTCGTATTTGAGCAAGCAGAAGTTTTTATTTA
TTATAAAATATAACAAAAAAAATAGGGAGCTGTTAATCACTTACTAGACTTCATTTTTAA
AGGATAAAAGAATATACAAAAAAAGGGAGCTGGCGAAGCTCAAACAAAATAAAGCAATTA
AAAAAAGAAACCTGAGTCAAAAAAGAAAAAGAAAAAGGACGAAGATGATGAAGATGGAGA
TGAGGATAACTTGAATGAAGAAGATGATAAAGGTTTAGAAGAAGAAACAACAAAATAAAC
AGCATAAAACGTTCATATTAGAAGACCAGTTATCTTTATTTGTAACGATATTTACAGTAA
AGGGTTAAGGGAACTTAGAAAAAAAGCCTTCGTATTTAATTTTACGAAAGCAAGGAGCGA
TAAGCTAGTACAAAGACTGAGAGAAATCTGCCATAAAGAAAAGTTAAGTATAGATTAATC
AGGATTATAAAAGATATGTGACCACAATGAGAACGATATAAGATCTACATTAATGAACCT
TTAAATGATATCAAAAATTCAAAAGCAAGACAATCGCTCTAAAATATCAATCGACTAAAT
TCTCATGGAAGAAAAAAACAACTCTAAAAGTATTTTAGAGCTCTTAGAGTGCATCATGAT
GCCTCCAATCAATAAAAAGGACTCTAAAATTGAGTAATGAAAATAATATTTAATTTAAAT
TAATAGATTTTAGTAGATTTAATGGAGATCATAGAAATAGCACTTAAATAAAAAAATAAT
TTATTAATTTTAATTCTTTATTTAATTAATTAGTATTTTGAGATACACTATACATACTCT
AATTAAAAACACATAACCTGATTAACTGATAGAAGCAACACTTTTAAACTATAGCAAAAT
AAAAAATACTGAGAGATTCTTTGATAAAATACCTTAGTTTTTGGTAAAATCTTTATAAAA
AGTTAATTTAAGTTTTTTAATTATTAAATCATTTCATCTTTAATATAGGATGATTTATCT
TTGGCAGAAATTTTAGAAAGTAATTTGCTAAAACACAATTATGAAATGACAAAGTTTATA
TCGCTTCCAATTATAAATTTTGGTCTCAATCTTAAAGGTTAAGAAAGAGTAAAGCTAGAC
TTCCCTAGAGACAAATTCACTCTTAAAAAAAGATATGTAAAATTATTTAACAACATTTTG
AAATATCAAAAAAATTTAATAGAGTTTTCGAAAAGTCATTAAAATTTCGAACATAATTTT
TCTTTAAAATATTCAATAGAAAGCTGCCATGGATTGCATAGAAAGTTTACTAGAAAACCT
TCCAAACTCAGATGCTCCTTACTTAAATAATAAGAATTTCGTGCTAGATTATTTATCAAA
TATTTATTAAATAATACAGCCTAATATTTCATCTGTAAGTTCTAAGTCAAATTTATAAAA
GAGTTAATTATATTTTTTTAGAACATAATCAGTGACAGTGAAAAGAAAGACTTATACACT
TCTTTGAGCATTATGATAGACTTCTCTTTGAAATTATTAGATAATCCCTTTAAAATAGAT
AGAAGCGGTCAAAAATTTAATATATATTTTACTCCTTAAATAGAAAGATTGCTTTTATTT
GGAGTAAATAAATAAATAAATATTTAATTTAATCAAATGGAACATTTAATTATTATTAAT
CATTTTAGAACGATGTACCCGTATAAAGACTGAATGAGAGATCAATACACTTTATTTTAA
AAAATTATGATATAATAAACCATTAAAAAACACTGGCAAAAGATATGGCAGACGATGTAT
TACTTACTTACTTATTTACTTACTTACTTACTCTAACTACTTTATTGATTTATAAAGTTA
TTTATTTATTGTGTATTTTAGATAATTTTTAAAAATAATAAAATAGGAAATACAGTAAAA
GAAGCTTGAAGAAAAATTAATGAATATTGAAATGCTTGACAATTAATACAATAAAAAAGC
TAACAAAAGAAAAAAAAGAATAGAAGGAGAAGATGCTTCATTTTTATATAAATTTAGGGA
AGGAGTTAGTATTCCTATAAAGTACGATGTAAAAATGTCATAGCTCTTCATGTGA