Identifiers and Description

Gene Model Identifier

TTHERM_00997720

Standard Name

CSY1 (Fusion between cyclophilin peptidyl-prolyl cis-trans isomerase and SYF2 pre-mRNA splicing factor)

Aliases

PreTt24997 | 188.m00073

Description

Fusion between cyclophilin peptidyl-prolyl cis-trans isomerase and SYF2 pre-mRNA splicing factor

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08231 ) SYF2 splicing factor
  • ( PF00160 ) peptidyl-prolyl cis-trans isomerase, cyclophilin-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13%

TetraMine Data

TTHERM_00997720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20926.19.997093137033517e-262peptidyl-prolyl cis-trans isom
erase, cyclophilin-type family
protein (476 aa)
OxytrichaContig19483.0.g1033.998986577109865e-118Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD
DictyBaseDDB_G02836634.000904604388404e-59ppiD on chromosome: 4 position
943186 to 944382
WormBaseWBGene000008876.998985483803218e-56locus:cyn-11 Peptidyl-prolyl
cis-trans isomerase 11 stat
us:Confirmed UniProt:P52018
protein_id:CAA91297.1
SGDYDR155C1.0002546821282671e-50CPR1 Cytoplasmic peptidyl-prol
yl cis-trans isomerase (cyclop
hilin), catalyzes the cis-tran
s isomerization of peptide bon
ds N-terminal to proline resid
ues; binds the drug cyclospori
n A
Stentor CoeruleusSteCoe_216621.2160992992528256e-37

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00997720(coding)
ATGTCTAACAAAAAGAAAGCTATTTAGGTTTACTTAGATTTTATGGTTGGCAGCAAACCT
TTAGGTAGAGTAGTCTTTGAGCTGTTTACAGACTTAACCCCTAAAACTGCTGAAAATTTT
AGAGGGTTATGCACTGGTGATTATGGATAATCTGGCCTTAGTGGAAGAAACGCTAAATTA
TGGTATGAGAATAGCAAAATTCATAGAATCGTAGATAATTTTTGCATTTAAGGTGGAGAT
ATAACAAATGGTGATGGAACAGGAGGGTTCTCTATTTATGGTAGACACTTCGCAGATGAG
GATCTATCAAGACGCCACACTTGTGCAGGTTTGCTATCTATGGCTAACTCAGGAAGAAAT
ACTAATAGCTCATAATTTTTTATCACTCTTAAAGCAGCTCCTCATCTTGATGGAAAGCAT
GTTGTATTTGGTTAAGTTATTGATGGCATGGATATAGTAAGATAAATAGCTAAAGTACCA
GTTGATTTAAATGATAGACCAAAAATACCTGTTATTATTAGATAATGTGGTGAAGTAGGT
GACAAAAGAGCATTTTTGAGGGATGATCCTTTCTCAAAACAAAGTTATGAAGAAATCTAA
CAAAGAAAAACTCAAGCAGAAGAACTAAGAAGATAGGGTATTGATCCTGAAGAGTATTTT
AAGAAATTAGACGAAAAAGAGGAAAAATTAAACGAAATCGACGAGAGCTTAAAAGTTTTG
TAGCAATTAGAGGAAAAGATTAATGAAGTTAAAGAGAAACCGATCACTGAAATGAATGAG
AGTACAATAAAGGAAGACGTTATTGCGAGTGATAAAAGCAAATTAAATGAAAAATAAAAA
GATAGACTGCGTGAAATTCGCTTGAAATTAAATGAAGCTAAGAAGCTAAATAGTTTAGCC
GTCTTAGAAGAGGAAAAGAGAGCTGTAGATCCATATTATGAAAAGAATAAAAAGAAAGAG
ATCATCAAAGATAAGGCATAAAAAAAGCAAGAAGAGCTCATTAAGAAAGGCTTTGAAAAA
AATTAATAATACATGGAATAGTCAGCTATTAAGCAAGAAATATTTTAGGGAAAAGAAAAG
AAAAATACCACAGATAACTTTGGATGGAATGTATTCAATTCTGATACTTTATATGGAGCC
TATGAGAAGAGATGCAAAAATCTAGTATTTAATGAAGAGCAATATAAATAGTAAGTTGAA
AATCCTCACCAAGAATTCCAACCCACAGAAGAATCCTTACATAGATTATAGCAAGATATG
GATTAATAAAAAGCAAAGAAAAAAGAATTCAGCAGAAGAAGAGGATTCGACGAACAAAAT
ATAGATTTCATTGATGAAAGAAACAGAGTTTTTAACAATAAAATTAAAAGACATTTTTCA
GAATATACCAAAGAAATAAAAGCTAATTTAGAAAGAGGAACAGCTCTTTGA


>TTHERM_00997720(protein)
MSNKKKAIQVYLDFMVGSKPLGRVVFELFTDLTPKTAENFRGLCTGDYGQSGLSGRNAKL
WYENSKIHRIVDNFCIQGGDITNGDGTGGFSIYGRHFADEDLSRRHTCAGLLSMANSGRN
TNSSQFFITLKAAPHLDGKHVVFGQVIDGMDIVRQIAKVPVDLNDRPKIPVIIRQCGEVG
DKRAFLRDDPFSKQSYEEIQQRKTQAEELRRQGIDPEEYFKKLDEKEEKLNEIDESLKVL
QQLEEKINEVKEKPITEMNESTIKEDVIASDKSKLNEKQKDRLREIRLKLNEAKKLNSLA
VLEEEKRAVDPYYEKNKKKEIIKDKAQKKQEELIKKGFEKNQQYMEQSAIKQEIFQGKEK
KNTTDNFGWNVFNSDTLYGAYEKRCKNLVFNEEQYKQQVENPHQEFQPTEESLHRLQQDM
DQQKAKKKEFSRRRGFDEQNIDFIDERNRVFNNKIKRHFSEYTKEIKANLERGTAL


>TTHERM_00997720(gene)
ATGTCTAACAAAAAGAAAGCTATTTAGGTTTACTTAGATTTTATGGTTGGCAGCAAACCT
TTAGGTAGAGTAGTCTTTGAGCTGTTTACAGACTTAACCCCTAAAACTGCTGAAAATTTT
AGAGGGTTATGCACTGGTGATTATGGATAATCTGGCCTTAGTGGAAGAAACGCTAAATTA
TGGTATGAGAATAGCAAAATTCATAGAATCGTAGATAATTTTTGCATTTAAGGTGGAGAT
ATAACAAATGGTGATGGAACAGGAGTAATTAAATTATTTACTCTATTAATCAAGAGAATA
AAATTTGTATTTTATAATTATATTAGGGGTTCTCTATTTATGGTAGACACTTCGCAGATG
AGGATCTATCAAGACGCCACACTTGTGCAGGTTTGCTATCTATGGCTAACTCAGGAAGAA
ATACTAATAGCTCATAATTTTTTATCACTCTTAAAGCAGCTCCTCATCTTGATGGGTATT
ATTGAATTAATTTATTAAAAGGTAAATTAGAATTATAAATATAAAAAATAGAAAGCATGT
TGTATTTGGTTAAGTTATTGATGGCATGGATATAGTAAGATAAATAGCTAAAGTACCAGT
TGATTTAAATGATAGACCAAAAATACCTGTTATTATTAGATAATGTGGTGAAGTAGGTGA
CAAAAGAGCATTTTTGAGGGTAACTTAAATAAATTTATATTTAATAATTTTAATTGATTT
TTATTTTTATAGGATGATCCTTTCTCAAAACAAAGTTATGAAGAAATCTAACAAAGAAAA
ACTCAAGCAGAAGAACTAAGAAGATAGGGTATTGATCCTGAAGAGTATTTTAAGAAATTA
GACGAAAAAGAGGAAAAATTAAACGAAATCGACGAGAGCTTAAAAGTTTTGTAGCAATTA
GAGGAAAAGATTAATGAAGTTAAAGAGAAACCGATCACTGAAATGAATGAGAGTACAATA
AAGGAAGACGTTATTGCGAGTGATAAAAGCAAATTAAATGAAAAATAAAAAGATAGACTG
CGTGAAATTCGCTTGAAATTAAATGAAGCTAAGAAGCTAAATAGTTTAGCCGTCTTAGAA
GAGGAAAAGAGAGCTGTAGATCCATATTATGAAAAGAATAAAAAGAAAGAGATCATCAAA
GATAAGGCATAAAAAAAGCAAGAAGAGCTCATTAAGAAAGGCTTTGAAAAAAATTAATAA
TACATGGAATAGTCAGCTATTAAGCAAGAAATATTTTAGGGAAAAGAAAAGAAAAATACC
ACAGATAACTTTGGATGGAATGGTAAGTTTCTTTTTTTTCATCTTTCATATATTTTTAAT
ATATTTTATTTTCCATCACAAATAAATTATATTACAAAAAAAATACAATTTCTATTAAAC
ATTAAATTAATTTATTTAGTATTCAATTCTGATACTTTATATGGAGCCTATGAGAAGAGA
TGCAAAAATCTAGTATTTAATGAAGAGCAATATAAATAGTAAGTTGAAAATCCTCACCAA
GAATTCCAACCCACAGAAGAATCCTTACATAGATTATAGCAAGATATGGATTAATAGTAA
TTTTTTAATATTAATTTAGATTTTTAAAAAAAGCTAATTTTTCTAAAATAAAACAGAAAA
GCAAAGAAAAAAGAATTCAGCAGAAGAAGAGGATTCGACGAACAAAATATAGATTTCATT
GATGAAAGAAACAGAGTTTTTAACAATAAAATTAAAAGACATTTTTCAGAATATACCAAA
GAAATAAAAGCTAATTTAGAAAGAGGAACAGCTCTTTGA