Identifiers and Description

Gene Model Identifier

TTHERM_00354990

Standard Name

CSL4 (exosome complex component CSL4)

Aliases

PreTt27485 | 37.m00202 | 3836.m02288

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00575 ) S1 RNA binding domain
  • ( PF03017 ) TNP1/EN/SPM transposase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00354990

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02327.19.997962730346853e-122hypothetical protein (194 aa)
DictyBaseDDB_G02853778.00089003463867e-30DDB_G0285377 on chromosome: 4
position 3204171 to 3204931
OxytrichaContig21513.0.g337.002638123733849e-21Exosome component EXOSC1/CSL4
SGDYNL232W5.999654353873483e-20CSL4 Exosome non-catalytic cor
e component; involved in 3-5 R
NA processing and degradation
in both the nucleus and the cy
toplasm; predicted to contain
an S1 RNA binding domain; has
similarity to human hCsl4p (EX
OSC1)
WormBaseWBGene000129660.000000000000008995967261938872locus:exos-1 status:Confirme
d UniProt:Q9XXD2 protein_i
d:CAA19529.1
Stentor CoeruleusSteCoe_338680.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00354990(coding)
ATGAACGTTTATCTACCTGGTTAAAGTTTAAATTTACCTCAAGGGAATGTTAGATATTCA
GCAGGATAAGGATGCTATGAATTGAATGGCAAAATATTTGCTTCTATTTGCGGAAAATGC
TAAATTGATAAAGACAATATAGTAAGTATAGTTCCTTTAGGCAACAAAGTAGCAAATTTA
CAAGTTGGCTCAATAGTGACAGCTAAGGTGTTAAGAATTAGAGACAATAAAGTTGAAGTC
AAAATAATGATGGTAGAAGATGCTGTGATTAACTATAATTTATAAGGAATAATTAGAAAA
TAAGATGTTAGATAAACTAATTTAGATATTTTAAAAATGGAGGAATAATTTATTCCAGGA
GATATCATTAAAGCTAGATTTATATCATATGGCGATTCATAAAAATTATATTTGTCTGTG
ACCGAAGATGAATTAGGAGTAGTTTTTGCTAAGCATACTGAATCTAAATAGCTAATGATT
CCTTTCAGTTGGGAAGAAATGATTTGTGTATAAACTGGATAAAAAGAAAAAAGAAAAGTA
GCTAAACCAAATATATCTTTATTCTCTGCTTAAATGTAATGA


>TTHERM_00354990(protein)
MNVYLPGQSLNLPQGNVRYSAGQGCYELNGKIFASICGKCQIDKDNIVSIVPLGNKVANL
QVGSIVTAKVLRIRDNKVEVKIMMVEDAVINYNLQGIIRKQDVRQTNLDILKMEEQFIPG
DIIKARFISYGDSQKLYLSVTEDELGVVFAKHTESKQLMIPFSWEEMICVQTGQKEKRKV
AKPNISLFSAQMQ


>TTHERM_00354990(gene)
ATGAACGTTTATCTACCTGGTTAAAGTTTAAGTAATAAATTAGTGATATAAGAATTTTAT
TTAAAGAGGCTATTAAATAAAAAATAGATTTACCTCAAGGGAATGTTAGATATTCAGCAG
GATAAGGATGCTATGAATTGAATGGCAAAATATTTGCTTCTATTTGCGGAAAATGCTAAA
TTGATAAAGACAATATAGTAAGTATAGTTCCTTTAGGCAACAAAGTAGCAAATTTACAAG
TTGGCTCAATAGTGACAGCTAAGGTAAATCTTTAAATTGAAAGTATTATGAAAATATAAG
TTATTTTGCATACTTATTAGGTGTTAAGAATTAGAGACAATAAAGTTGAAGTCAAAATAA
TGATGGTAGAAGATGCTGTGATTAACTATAATTTATAAGGAATAATTAGAAAATAAGATG
TTAGATAAACTAATTTAGATATTTTAAAAATGGAGGAATAATTTATTCCAGGAGATATCA
TTAAAGCTAGATTTGTAATTATTTAAATTAAATAATTTGAACCTCATTTTTCTAAATTAA
TTAAAGATATCATATGGCGATTCATAAAAATTATATTTGTCTGTGACCGAAGATGAATTA
GGAGTAGTTTTTGCTAAGCATACTGAATCTAGTAATAAAAGAATTCAAATATTTTAATTA
ATTTTTATTTAAATTTAATAGAATAGCTAATGATTCCTTTCAGTTGGGAAGAAATGATTT
GTGTATAAACTGGATAAAAAGAAAAAAGAAAAGTAGCTAAACCAAATATATCTTTATTCT
CTGCTTAAATGTAATGA