Identifiers and Description

Gene Model Identifier

TTHERM_00780530

Standard Name

CSK1 (CaSein Kinase 1)

Aliases

PreTt01265 | 130.m00075 | 3738.m00011

Description

Casein kinase II regulatory subunit family protein; associated with transcription factor interaction in DNA repair pathway of macronucleus

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF01214 ) Casein kinase II regulatory subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.5%

TetraMine Data

TTHERM_00780530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18649.19.997093137033517e-262hypothetical protein (261 aa)
OxytrichaContig1990.0.g44.000179013191958e-98Casein kinase II regulatory su
bunit
DictyBaseDDB_G02846015.9995872346509964e-61csnk2b on chromosome: 4 positi
on 2209637 to 2210617
WormBaseWBGene000021967.001890014428386e-55locus:kin-10 Casein kinase I
I subunit beta status:Confir
med UniProt:P28548 protein
_id:CAB00053.1
SGDYOR039W9.999142814001536e-47CKB2 Beta regulatory subunit o
f casein kinase 2 (CK2), a Ser
/Thr protein kinase with roles
in cell growth and proliferat
ion; CK2, comprised of CKA1, C
KA2, CKB1 and CKB2, has many s
ubstrates including transcript
ion factors and all RNA polyme
rase
Stentor CoeruleusSteCoe_310651.1089390193121365e-40

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00780530(coding)
ATGTCAGAGGACTCATAATATTCTGATCTTCCTGGTGGTTGGATTAGCTGGTTTTGTGCT
CTTGAGGATCACTAATTTTTATGTGAAGTTGATGATGATTACATCAGAGATAACTTTAAT
CTTTATGGAATTAAGCAAAAGTTCAATCACTACAACGATACTATTGAAATGATTTTATCC
AGTGAAAGTCCCGATGATGATGATCTTGAAGATGAAAGATTTTTAGAAATCTACTAGGAA
GCAACTGACGTTTATGGTTTAATTCACGCTCGTTTCATTACTTCCCCAAAAGGATTAGCT
TTAATGAGAGAAAAGTTCTTGTTGGGCCGTTTCGGAGTTTGTCCTAGAGTACTTTGTGAA
AGACAAAATGTCTTACCTGTTGGTATGAGTGAAGAGCTTAGAACATCCAGAGTCAAAGTT
TATTGCCCTCGTTGTGAAGATGTATATATTCCTAAGAAAAAATGTCCTGATATCGATGGA
TGTTATTTCGGTGTTTCCTTCCCTCAAATCCTTCTTATGACATACCCTGATTTAGTCCCA
TCAAGAAACAATTCCACTTATATTCCTAGAATTTACGGTTTCAGAATATACAAGAAAAAG
GGATCTAAGTTCCTTGAAGAAGAAAACCCTTTGGTAGAAGTAACACATTATAGTGAAGAG
CTATTAAGACAAATAAGGGGAAAAGTTGATAAAAAAAATGAAGAAAAGAAAGCATTAACC
AACTCAACAACTGCTTAGAGTTACGGAAATACCTAAAATAATAACGCCAATCAAATGAAT
AACTGA


>TTHERM_00780530(protein)
MSEDSQYSDLPGGWISWFCALEDHQFLCEVDDDYIRDNFNLYGIKQKFNHYNDTIEMILS
SESPDDDDLEDERFLEIYQEATDVYGLIHARFITSPKGLALMREKFLLGRFGVCPRVLCE
RQNVLPVGMSEELRTSRVKVYCPRCEDVYIPKKKCPDIDGCYFGVSFPQILLMTYPDLVP
SRNNSTYIPRIYGFRIYKKKGSKFLEEENPLVEVTHYSEELLRQIRGKVDKKNEEKKALT
NSTTAQSYGNTQNNNANQMNN


>TTHERM_00780530(gene)
ATGTCAGGTACTTTAAAATAATTTTTTAGCTTTTTTGTTTACTTAGGACCACTAATTATA
GCGAAACGCTAAAAGAATGTTTAAAAGCAAAACAAAATAGCCTTGCTTATTAAGCAAAAT
ATAAAATACAATAGTTTGACTTTCATTTAAAATTAATTTGCATTATAAATAAAATAGAGG
ACTCATAATATTCTGATCTTCCTGGTGGTTGGATTAGCTGGTTTTGTGCTCTTGAGGATC
ACTAATTTTTATGTGAAGTTGATGATGATTACATCAGAGATAACTTTAATCTTTATGGAA
TTAAGCAAAAGTTCAATCACTACAAGTAAAAAAGATATCCAAAATAGATCTGTTTCACTT
CTTTTTTGATAATTTGATTTAAGTTCTCAAATTTTTCAAACATAATTAATAGTCACTAAA
TAAGAAAAGAATTATGAAAAAAGAGATATTTTAAAGCTTTTATTAGAATAAAATTATTAA
ATTAAAAGTCTTTATTACCCATTAATAATCATTTTATTAAACAGCGATACTATTGAAATG
ATTTTATCCAGTGAAAGTCCCGATGATGATGATCTTGAAGATGAAAGGTAATTAATACAA
AAATTGTTTATTTTTAATAGCAAAAACAAAATATTTATTTTAAATGATTGAATAGCTTTT
AGCTAATACTTAGTAAATTAACTGTAGCTATTTTGTTTATATAAGTTTTTAAAGATAGCC
TAATATAAATAGATATTTATTGAAGTTATTTAATCAAAAAAACTGTTAAGATTTTTAGCA
TATTATCAAAAGATTAAAAAAATATTTAATCGAATTATCTTTTCTTAAAATATAGATTTT
TAGAAATCTACTAGGAAGCAACTGACGTTTATGGTTTAATTCACGCTCGTTTCATTACTT
CCCCAAAAGGTATTTTTGAAATTATTTTATTTTAACAATTAAAATATAGATTTAGATATC
ATTAAAGCTAGCAAGCAAGCCAGTTTAACTAAAGATTTAATTTATTTAGCTGCATTCTAA
AATAAAAAAATTTGAACTTTATTCAAATTATTTAAGAAAGATAAATTACATACAATAAAT
AATAGACTATTTATTTATTTATTTATTTATTTCTACTGTTCCTTCTATTTAATTTAATAC
AATAAAATAGTTAACTAATTTATTTATTTTATGTTACAGGATTAGCTTTAATGAGAGAAA
AGTTCTTGTTGGGCCGTTTCGGAGTTTGTCCTAGAGTACTTTGTGAAAGACAAAATGTCT
TACCTGTTGGTATGAGTGAAGAGCTTAGAACATCCAGAGTCAAAGTAATAAAATTAACTT
AAATTAAATTAAGCTATTATTGAATGAGTAGCATTTATTTTGCAAATATATTTTATTATT
TATGTGGCTAACTTAAAAATTAATTTTTGTTTCAAATTAATAGGTTTATTGCCCTCGTTG
TGAAGATGTATATATTCCTAAGAAAAAATGTCCTGATATCGATGGATGTTATTTCGGTGT
TTCCTTCCCTCAAATCCTTCTTATGGTAATTAAAACTTTAGATGATAAAGATAGCATTTA
ATTAAACATTTAAAATTTATTATAAAAGACATACCCTGATTTAGTCCCATCAAGAAACAA
TTCCACTTATATTCCTAGAATTTACGGTTTCAGAATATACAAGAAAAAGGGATCTAAGTT
CCTTGAAGAAGAAAACCCTTTGGTAGAAGTAACACATTATAGTGAAGAGCTATTAAGACA
AATAAGGGGAAAAGTTGATAAAAAAAATGAAGAAAAGAAAGCATTAACCAACTCAACAAC
TGCTTAGAGTTACGGAAATACCTAAAATAATAACGCCAATCAAATGAATAACTGA