Identifiers and Description

Gene Model Identifier

TTHERM_00560000

Standard Name

CRS1 (cysteinyl-tRNA synthetase 1)

Aliases

PreTt27861 | 74.m00138 | 3720.m00029

Description

cysteinyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00560000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16175.19.997093137033517e-262cysteinyl-tRNA synthetase (724
aa)
OxytrichaContig16632.0.g727.003368684633018e-175tRNA synthetases class I (C) c
atalytic domain
DictyBaseDDB_G02871599.998596099208102e-158cysS on chromosome: 4 position
5412959 to 5415025
SGDYNL247W1.0004559842325763e-117YNL247W Cysteinyl-tRNA synthet
ase; may interact with ribosom
es, based on co-purification e
xperiments
WormBaseWBGene000008004.997537656037722e-111locus:cars-1 status:Partiall
y_confirmed UniProt:Q965I6
protein_id:CCD70916.1
Stentor CoeruleusSteCoe_178231.314164668364901e-67

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00560000(coding)
ATGATTAAATAGATTACTAATCTAACAAAAACATTAAAAAAACGATTTTTGCAAGTGCCA
AAATATCCTTTTGGAAATAGCTGCTGCAACAAGAATTTATAAATAGCGAATCTCTTCTCT
ACTAATTAAAAAATGACAACTGAGGTAAAAAAAGACCCCTATCAATTATGGCAACTCCCT
GTTAAAGATGAAACCAAGTATTTAACAGGTCTTAAAGTTAAAAACACCTTAAATCCTTAG
AATTTAGTTGAATTCGTCCCTCACAAAGGCAAATAAGTTAGATTCTACAACTGTGGCCCT
ACAGTTTATGATTCTTCACACATTGGTCATGCCAGAACTTACATTTCTGCAGATATTATC
AAAAGAATTATGGTTAAGTACTTTGGCTATGATGTTTTCCACTGTATGAATATTACTGAC
ATAGATGACAAGATCATTAAAAAGTCAAATGAAAGTGGTGAAGAATTTACTGCCTTTGCC
AGAAAATGGGAAATGGATTACTGGTAAGACATGGAAACATTAAATGTTGATAAGCCTGAT
GTCATAGTCAGAGTTAGCGAATATGTACCAGAAATTATTTCTTACATTGAAAAAATTATT
GAAAATGGCTACGCTTATGTCGCTAATGGCTCCGTTTACTTCAATGTTGATAAATTCCAC
GAGTCTCCAACTCATTGCTACTCTAAACTCGAACCTCAAAGTGTTAATGATGCTTAAAAG
CTAGACGAAGGTGAAGGTGCTCTTGGCAAAAAAGATGAAAAGGAAAAAAGATCTCCTAGA
GACTTTGCTTTGTGGAAAGCAAGCAAACCTGGTGAGCCCTTCTGGGATAGTCCTTGGGGC
TAAGGTCGTCCTGGATGGCACATTGAATGTTCAACTATGGCCTCCGAAATTCTTGGATAT
CCAGTCGATATCCATATGGGAGGAGAAGACTTGAAATTCCCTCACCACGATAACGAATTG
GCTTAGAGTGAAGCCTTTTATAATAAATAAGATTGCTAAAATCAATGGGTTAACTACTTC
ATGCATACAGGCCATTTGCACATTGATGGATTAAAAATGTCAAAGAGTTTAAAAAATTTC
ATTACCATTAAGCATTTATCCAGCCAACACAGCTAGCGCGTTTTAAGACTTCTCTTTATG
AAATAAACATATGACTCTACAATGGATTACACCACTGATTCAATACATGAAGCTAAAACA
AAAGATAAAAAGTATTCAGAATTTTATCTTACAATGAACGCCATACTTCTTTAATCAGAA
ATCAATGTCCCATAGAAGTGGGGTCCTAGAGAATTTGAATTAAGAGACTTGTTTGTTGAA
AAGCAAGATAACATCCACAGGGCATTCTAAAAAAATTTCAATGTCCCTGAAGCACTTAAA
GAGCTTGACGAAATCATCACTGCTGTCAATACTTACATTAAGGAAAAGCCTATCATTCAT
CTTCTCATCAGAAGTATTTTCAACTACGTTAAGCATATTTTCAATTGCTTAGGTTTAATT
TATGAAAAGCAACAAGCTTAAGCTAAGGATGACACCTTCATTCGCACTGTTGGATTGATT
AGCAGTCTCAGAGATGAGATCAGAGGTGCAAACAAAGATTTGCAAGTTATCAACAAGGCA
GCTATTAATGCTAAGTCTTCTCTTGGTGAAATAACCTTAAAACTAGAACCAAATGCTAGT
GAAAGTGCTGTTTAGATTGCCACAGACTACATAACTTAAGTATTAAAATGTGTTGAAGAT
AACTAACTTTAACAGATTTATAAGGCTTCAGATGAAATCAGAGATGAAAAACTGATTTAG
ATTGGTATCCGTATTGATGATGGTAAACCTGGTGAGCCCAGTTTATGGAAAATCGATGAT
AAAGAAACTTTGCTAAAAGAGAAAGAAGAGAAAATACTCAAAGAAAAATAAAAAGAAGAA
GAAAAGCGCAAAAAAGAAGAAGAAAAATTGAAAGCTATGAGTGTGAATCCAGCAGAAATG
TTTAAAAATGATCCTAACTATAGCAAGTACCAATTTGATGAAAGAGGTATTCCTAGTCAC
GATGAAAAGGGCACTCCTCTTAAAGAAAAAGCTATTTAATCTTTTGTTAAAAAATACGAT
GCACAAAAGAAGCTCTATGAACAATACCTTGAAAAAACATCAAAAAAGTGA


>TTHERM_00560000(protein)
MIKQITNLTKTLKKRFLQVPKYPFGNSCCNKNLQIANLFSTNQKMTTEVKKDPYQLWQLP
VKDETKYLTGLKVKNTLNPQNLVEFVPHKGKQVRFYNCGPTVYDSSHIGHARTYISADII
KRIMVKYFGYDVFHCMNITDIDDKIIKKSNESGEEFTAFARKWEMDYWQDMETLNVDKPD
VIVRVSEYVPEIISYIEKIIENGYAYVANGSVYFNVDKFHESPTHCYSKLEPQSVNDAQK
LDEGEGALGKKDEKEKRSPRDFALWKASKPGEPFWDSPWGQGRPGWHIECSTMASEILGY
PVDIHMGGEDLKFPHHDNELAQSEAFYNKQDCQNQWVNYFMHTGHLHIDGLKMSKSLKNF
ITIKHLSSQHSQRVLRLLFMKQTYDSTMDYTTDSIHEAKTKDKKYSEFYLTMNAILLQSE
INVPQKWGPREFELRDLFVEKQDNIHRAFQKNFNVPEALKELDEIITAVNTYIKEKPIIH
LLIRSIFNYVKHIFNCLGLIYEKQQAQAKDDTFIRTVGLISSLRDEIRGANKDLQVINKA
AINAKSSLGEITLKLEPNASESAVQIATDYITQVLKCVEDNQLQQIYKASDEIRDEKLIQ
IGIRIDDGKPGEPSLWKIDDKETLLKEKEEKILKEKQKEEEKRKKEEEKLKAMSVNPAEM
FKNDPNYSKYQFDERGIPSHDEKGTPLKEKAIQSFVKKYDAQKKLYEQYLEKTSKK


>TTHERM_00560000(gene)
ATGATTAAATAGATTACTAATCTAACAAAAACATTAAAAAAACGATTTTTGCAAGTGCCA
AGTAATTTATTATTATTATTTCAACTCAATCAGGGATTTGGATGTGACATAACCCTCTTT
TTCAAGCCTTTTGCAGATTGAATTTTTGACATTTTAGTATTAGGAGTTAAGAAAGTCAAT
CAAACACTTAGACAAAATACTTGCTAATTAATTAGCAATTTTTTGCTTTTATTAAAAAGG
TTATAGTCTCCAAACAAATCCTCACTAAAAATTTTATTAACTTAAGATAGATCTTAATTA
TTTTATATAAAATTAATTAAAAGAATATCCTTTTGGAAATAGCTGCTGCAACAAGAATTT
ATAAATAGCGAATCTCTTCTCTACTAATTAAAAAATGACAACTGAGGTAAAAAAAGACCC
CTATCAATTATGGCAACTCCCTGTTAAAGATGAAACCAAGTATTTAACAGGTCTTAAAGT
TAAAAACACCTTAAATCCTTAGAATTTAGTAAATTTTTGACTTTTAAGTTTAATAGCTTT
TTTGCATAATAATTTTCATATTTGAATAATTTCTAAATTTTGTTATTTAAAGGTTGAATT
CGTCCCTCACAAAGGCAAATAAGTTAGATTCTACAACTGTGGCCCTACAGTAAAGCATTT
TCTAAGTTTACTAAGATTTTTAAACATTTTTTTCCATTATAATTTTAAATTTTGCAGCTT
TTGTTTACTGCGCTGCATAAATTAATTGGATAGCGAAAAAGGAAAAAGCACAAATAAAAA
TAAAATAAATTTAGATAGGTCTTTTAATTAAATGAAATATTATATAGGTTTATGATTCTT
CACACATTGGTCATGCCAGAACTTACATTTCTGCAGATATTATCAAAAGAATTATGGTTA
AGTACTTTGGCTATGATGTTTTCCACTGTATGAATATTACTGACATAGATGACAAGATCA
TTAAAAAGTCAAATGAAAGTGGTGAAGAATTTACTGCCTTTGCCAGAAAATGGGAAATGG
ATTACTGGTAAGACATGGAAACATTAAATGTTGATAAGGTAATCAATCATTTTTATATAA
TTAATTTAAATAAGTTTAGCAATAAGCATTATTAAGCCTTTTTATTTAAACTTAATAGCC
TGATGTCATAGTCAGAGTTAGCGAATATGTACCAGAAATTATTTCTTACATTGAAAAAAT
TATTGAAAATGGCTACGCTTATGTCGCTAATGGCTCCGTTTACTTCAATGTTGATAAATT
CCACGAGTCTCCAACTCATTGCTACTCTAAACTCGAACCTCAAAGTGTTAATGATGCTTA
AAAGCTAGACGAAGGTGAAGGTGCTCTTGGCAAAAAAGATGAAAAGGAAAAAAGATCTCC
TAGAGACTTTGCTTTGTGGTAAGAAATTAAATATGATAAACATACATACATATAAACAAA
CAAATAGTTTTTATTATCATTTTGCATTTCAAAAAATAAAATCTTGTTAATTTAGAAGAT
TATTTAAAGGTTATTTAAATTAATTATTAATTCAACAGGAAAGCAAGCAAACCTGGTGAG
CCCTTCTGGGATAGTCCTTGGGGCTAAGGTCGTCCTGGATGGCACATTGAATGTTCAACT
ATGGCCTCCGAAATTCTTGGATATCCAGTCGATATCCATATGGGAGGAGAAGACTTGAAA
TTCCCTCACCACGATAACGAATTGGCTTAGAGTGAAGCCTTTTATAATAAATAAGATTGC
TAAAATCAATGGGTTAACTACTTCATGCATACAGGCCATTTGCACATTGATGGATTAAAA
ATGTCAAAGAGTTTAAAAAATTTCATTACCATTAAGCATTTATCCAGCCAACACAGCTAG
CGCGTTTTAAGACTTCTCTTTATGAAATAAACATATGACTCTACAATGGATTACACCACT
GATTCAATACATGAAGCTAAAACAAAAGATAAAAAGTATTCAGAATTTTATCTTACAATG
AACGCCATACTTCTTTAATCAGAAATCAATGTCCCATAGAAGTGGGGTCCTAGAGAATTT
GAATTAAGAGACTTGTTTGTTGAAAAGCAAGATAACATCCACAGGGCATTCTAAAAAAAT
TTCAATGTCCCTGAAGCACTTAAAGAGCTTGACGAAATCATCACTGCTGTCAATACTTAC
ATTAAGGAAAAGCCTATCATTCATCTTCTCATCAGAAGTATTTTCAACTACGTTAAGCAT
ATTTTCAATTGCTTAGGTTTAATTTATGAAAAGGTAATTAATTTTGATTCATTGTTTCGT
TTGATAGAATAATTTTTATGGAAGGAAAGAGAAGTTTTTAATTAAATAAAATCAATTAAT
TTCTCAATTTCTAGAGTTTTATTTTAATATTTTACCACAAATTAAAAGAAATGAATGAAA
AGTGCTAAATAATAAATTTTCGATTTGGAGTTAATTATATTTATTGTCTGTACTTTTTAG
CATCAATCTTTTAGTTTTTTTTTATTATATAATTTTTATTTTGTCTGTCTAAGACATTTT
TTATCATTTACTTTATTTTATTACAGCAACAAGCTTAAGCTAAGGATGACACCTTCATTC
GCACTGTTGGATTGATTAGCAGTCTCAGAGATGAGATCAGAGGTGCAAACAAAGATTTGC
AAGTTATCAACAAGGCAGCTATTAATGCTAAGTCTTCTCTTGGTGAAATAACCTTAAAAC
TAGAACCAAATGCTAGTGAAAGTGCTGTTTAGATTGCCACAGACTACATAACTTAAGTAT
TAAAATGTGTTGAAGATAACTAACTTTAACAGATTTATAAGGCTTCAGATGAAATCAGAG
ATGAAAAACTGATTTAGATTGGTATCCGTATTGATGATGGTAAACCTGGTGAGCCCAGTT
TATGGAAAATCGATGATAAAGAAACTTTGCTAAAAGAGAAAGAAGAGAAAATACTCAAAG
AAAAATAAAAAGAAGAAGAAAAGCGCAAAAAAGAAGAAGAAAAATTGAAAGCTATGAGTG
TGAATCCAGCAGAAATGTTTAAAAATGATCCTAACTATAGCAAGTACCAATTTGATGAAA
GAGGTATTCCTAGTCACGATGAAAAGGGCACTCCTCTTAAAGAAAAAGCTATTTAATCTT
TTGTTAAAAAATACGATGCACAAAAGAAGCTCTATGAACAATACCTTGAAAAAACATCAA
AAAAGTGA