Identifiers and Description

Gene Model Identifier

TTHERM_00313380

Standard Name

CRP1 (Calcium Regulator Protein 1)

Aliases

PreTt03525 | 30.m00334 | 3810.m01946

Description

Sodium/calcium exchanger protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00313380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06706.19.997093137033517e-262sodium/calcium exchanger prote
in (598 aa)
WormBaseWBGene000035721.0004783691736523e-35locus:ncx-7 Putative sodium/
calcium exchanger 7 status:P
artially_confirmed UniProt:P
34322 protein_id:CAA82341.3
OxytrichaContig21787.0.g1132.9993110246221282e-28Sodium/calcium exchanger prote
in
Stentor CoeruleusSteCoe_304480.000000000005109089028063325
SGDYDL206W0.000000005997038937208364YDL206W Putative protein of un
known function; YDL206W is not
an essential protein

General Information

Paragraph NoGene NameParagraph Text
51CRP1Tetrahymena thermophilia CRP1 (calcium regulator protein 1) appears to be a member of the sodium/calcium exchanger protein family. It contains one putative sodium/calcium exchanger domain, which has an E-value of 3.2*10^-13, indicating that it is reasonably related to this domain sequence. It is possible that this protein regulates Ca2+ cation concentration within the cell, where the movement of Ca2+ in or out of the cytoplasm is contingent upon the concentration of Na+ in the cell. M. Huen and M. Greeley

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00313380(coding)
ATGGCAGACTAATCTTAAATGTGTACTTTTAAAAAAATACAGGCATTGCAATAGCAAGAT
ATCTGTGCTTACGCAGATCAGCATTGCAATGTTGAGTAAATGATAAGATTTTCTTACTTT
TACTATTGCTAAGTCAATTAAAATATTCTTGTTTTAGACCTTCTTACAATATTGGTTCCA
TTTATTTCCTTCCGTTTACTAAGCTAAACATCTGAATACTACCTTTCCCCTTCATTAGCT
AAGCTAGCTAAGTGCTTTAGACTCTCTCAAACCTTGGCAGGCGTAACATTACTTGCCTTA
GGAAATGGTGGTCCTGATGTGATCACGGCAATTATTGCAGGAAACAGTGGAGATGATTCT
ATTTCTATAGCAGTTGGATCTATATTTGGCGCAGGGCTATTTGTGACAACTTACACTCTT
GCTAATTGTATTCAGAACGCCGGTTAAATCAAGATTCAATCTAGAACTTTTTTTAGAGAT
CAACTATTCTATTTAATTGGATGTTTGGTTATTCTCATCTACACAATAATAGGTGAAGTA
ACTTTAAGCATGTCAATTGGTTTTATAAGTATCTACATAATATTCTTGCTAGTTGTAGTC
TATTAAGATAAGACTAATCCACAAAAAAAAGAATCAGAGGATAGCACTAAGCAACAATAA
ACTATCAGAAAAATGGAAACAATGCAAACTTAAAAGATAGATGACATTCAAATCGAAATG
TAAATTGAATAAATGAGAAATGACCCCATGGCTATGATGCATAGACAAACAACTCTTGCT
GAATTTAGATAATCAGATCTCCCTCTTTGCGATCTAAAAGAGTCGAACGATTAAGACATG
AAGGATCAAGAAAACAAAGTTCCAAGCATCCCCATGATAATTATCCCCGAAGATTAAGAA
GAAGATGAAGAAAATGGGATTAGAAGCAAAAAATCTTCTTTAGAAGAATAATAAAAATAA
TAGTAGAACACTGAAGCTTTTGATACTCTAAAGAGATGCGATACTTAAAATTAAGCTCAA
ACTTATGAGTAAGCTGACGATGAATCAAGTAGTAAATCATCTAATGACTCTAATAACAAA
GATAGCATGACTGAAAAGTACGAAAACTTCAAGTAAAAGCTTCATGAAATGTCTGTCCCT
GAAAAAATCTTAGCTTTAGCTGAAATTCCTATTGACCTTATTAGATACTTCATCATCCCT
CCAGCTGAAGATTCTTAATGGAATAAAATAAGAGCGATTGTTTGTTGCTACACTTCTCCA
ATCGTGTTCCTCCTCTGCTTTGGAGGTATAACAATGCAAATTAATGGAGTTGAAGGATTT
TATGTTGCTTACCTTCTTCTTGCTATTTCTTTTGTATTATCAATTATTGTTTTCTTCTTT
ACCAAGAAAGACTAAGCTCCTTGTTTCCAATGGCTTTTTTCCTTAGGCTCAATATTTGTC
GCTATTGCAATTCTTAGTGTTATAGCCTAAGTCTTAGTAGATTTTATTAACTTTTTCTAG
CTTCTCACATCAATGAATAAAACTTTCTTGGGTATGACTCTTTTAGCCTTAGGAAACTCT
GCTACAGATTTCTTTACTAATTCATAACTTGCCAAAGTTGGATATGGTGTTATGGCTTTA
ACTGGATGCTTTGCTGGACAAGCATTTGATTTATACCTAGGATTCGGTTTTGCTTTAGTT
TTTAGCTCTTATAAACAAGGATTTGGTTTATCTATTTTCACAGGCTCTAACATCAATGAC
TGGTTTAGTAACAGTATTGCTATTACAATCTTAGTTTCTGTGATTATTTCAACCATAATT
ATACTCATATGTTCCATAAAACAAAATTACAATTTTGAAAAAGGAAAATTCACCAGCTTT
ATCAAAAATTACTACTTACTCATAATTACTATCTGCATAGGTCTCTGTGCAGCTGACTAA
TTCTTTGAATGA


>TTHERM_00313380(protein)
MADQSQMCTFKKIQALQQQDICAYADQHCNVEQMIRFSYFYYCQVNQNILVLDLLTILVP
FISFRLLSQTSEYYLSPSLAKLAKCFRLSQTLAGVTLLALGNGGPDVITAIIAGNSGDDS
ISIAVGSIFGAGLFVTTYTLANCIQNAGQIKIQSRTFFRDQLFYLIGCLVILIYTIIGEV
TLSMSIGFISIYIIFLLVVVYQDKTNPQKKESEDSTKQQQTIRKMETMQTQKIDDIQIEM
QIEQMRNDPMAMMHRQTTLAEFRQSDLPLCDLKESNDQDMKDQENKVPSIPMIIIPEDQE
EDEENGIRSKKSSLEEQQKQQQNTEAFDTLKRCDTQNQAQTYEQADDESSSKSSNDSNNK
DSMTEKYENFKQKLHEMSVPEKILALAEIPIDLIRYFIIPPAEDSQWNKIRAIVCCYTSP
IVFLLCFGGITMQINGVEGFYVAYLLLAISFVLSIIVFFFTKKDQAPCFQWLFSLGSIFV
AIAILSVIAQVLVDFINFFQLLTSMNKTFLGMTLLALGNSATDFFTNSQLAKVGYGVMAL
TGCFAGQAFDLYLGFGFALVFSSYKQGFGLSIFTGSNINDWFSNSIAITILVSVIISTII
ILICSIKQNYNFEKGKFTSFIKNYYLLIITICIGLCAADQFFE


>TTHERM_00313380(gene)
ATGGCAGACTAATCTTAAATGTGTACTTTTAAAAAAATACAGGCATTGCAATAGCAAGAT
ATCTGTGCTTACGCAGATCAGCATTGCAATGTTGAGTAAATGATAAGATTTTCTTACTTT
TACTATTGCTAAGTCAATTAAAATATTCTTGTTTTAGACCTTCTTACAGTATATATTTTA
TATTATGCGCATTCTATTATAATTAATTATTTATTTATTTATTTTGCTTTACTTTAGATA
TTGGTTCCATTTATTTCCTTCCGTTTACTAAGCTAAACATCTGAATACTACCTTTCCCCT
TCATTAGCTAAGCTAGCTAAGTGCTTTAGACTCTCTCAAACCTTGGCAGGCGTAACATTA
CTTGCCTTAGGAAATGGTGGTCCTGATGTGATCACGGCAATTATTGCAGGAAACAGTGGA
GATGATTCTATTTCTATAGCAGTTGGATCTATATTTGGCGCAGGGCTATTTGTGACAACT
TACACTCTTGCTAATTGTATTCAGAACGCCGGTTAAATCAAGGTAATTCTTCATTTGTCA
TTTTATTTGTTGTTGAAATATCTTTGTACTATTTGTTATTACTTCTATTATTGTTTAGTA
GTATTAAGGGGGATTTTATTGGTTTAATTTGAGGGATATATATTTATCTTTATATTTATA
CACAAATAAATAATCTATTTATCAATCTAACTTTCTTTTTTTCTTTCTTCCTTTACTATT
CACTTTACTTTGTGAATATTTTAAAATCCTAAAAGTAACAAGAATAAGCTGAGACAAATT
CAAATAAAAATAGAAGAAAAATTTAAATCCATTTTCTTTTCCCTAATTAATTTAATATTT
TATTTTTCTCCTCTTTATACTTTCAATTATTTCATAAATTCTGAAAAGCTAATTGATTAT
TTTTTTCATTAAGACTCTATAACTTATTTAGAATATTTCATGCATTTCAATGAATTTAAT
TCAAACATATTATGTATTATTAATAAATGCACTATTCACGAAAAATGAATATTTATTTTG
AAATAGCCAACTTCAATCTAATCAATAAATAAATGAAGGATAATAAATAACACAATGCTA
CAAAACAAAATAATTGATTTTTATTTACACCTTTTAGCAAATATCTAACAAAGCATTTTT
AAATAAAATTCTTTCATACATAAAATAAAATTGATTTGATTTGAAAAAAATGAAGATAAT
TTTTTCTAAAAATACTATACTTGCATTACAATTAAGTACTCTTACTTTTAAGTATTTATA
TAATCGATACGTGAGCTATTAATATATATGAATTTATTGCTAAAATATTTTATGTCTGTA
TTGCAAATTCTCTTATGAAAAAATGAGAGGGGATGGAGGGAGGGAGAAATTATTTTGAAA
TAAAATAGAAGAACAATGATTAATTTTAATTATTGTTGGATGTATAGCAAATTAATTAAT
TAATTTATTTTGTTTTTATTAATTTCAAAGATTCAATCTAGAACTTTTTTTAGAGATCAA
CTATTCTATTTAATTGGATGTTTGGTTATTCTCATCTACACAATAATAGGTGAAGTAACT
TTAAGCATGTCAATTGGTTTTATAAGTATCTACATAATGTAATTAATATAATTTATACAT
CACGTTCCATGTTTGTTAACAAATATTTTGTTTTAAATGCAATTAGATTCTTGCTAGTTG
TAGTCTATTAAGATAAGACTAATCCACAAAAAAAAGAATCAGAGGATAGCACTAAGCAAC
AATAAACTATCAGAAAAATGGAAACAATGCAAAGTAATTTTTTCTCCTCTAATTCCATCA
ACACTTTAACAATTTATACAGCTTAAAAGATAGATGACATTCAAATCGAAATGTAAATTG
AATAAATGAGAAATGACCCCATGGCTATGATGCATAGACAAACAACTCTTGCTGAATTTA
GATAATCAGATCTCCCTCTTTGCGATCTAAAAGAGTCGAACGATTAAGACATGAAGGATC
AAGAAAACAAAGTTCCAAGCATCCCCATGATAATTATCCCCGAAGAGTAAGATTATTTAA
TGAAAATTAAAATTTATAACCGCTTTTACAAATTGAATAGTTAAGAAGAAGATGAAGAAA
ATGGGATTAGAAGCAAAAAATCTTCTTTAGAAGAATAAGTAAATATTATTTATTTTTGAT
GTGTTTTATTTAAATTATTAAACGAATGAAATAATTAATATTACGTTTGTTAATAGTAAA
AATAATAGTAGAACACTGAAGCTTTTGATACTCTAAAGAGATGCGATACTTAAAATTAAG
CTCAAACTTATGAGTAAGCTGACGATGAATCAAGTAGTAAATCATCTAATGACTCTAATA
ACAAAGATAGCATGACTGAAAAGTACGAAAACTTCAAGTAAAAGCTTCATGAAATGTCTG
TCCCTGAAAAAATCTTAGCTTTAGCTGAAATTCCTATTGACCTTATTAGATACTTCATCA
TCCCTCCAGCTGAAGATTCTTAATGGAATAAAATAAGAGCGATTGTTTGTTGCTACACTT
CTCCAATCGTGTTCCTCCTCTGCTTTGGAGGTAAATTATTTATCTTTATTTACAAACTAC
TATACATATATACTTAAGCTTTATACTTTCATTTCACTGATTAAAGAACAGGCAAACAAA
GGATCATTTAATTTTTTTTAAGCACAAATAAATCTACTTTCTAAAAAAAACTGTTTAAAT
TCAAAAAATCCGTTTTTAGATTTATAACAACTATTTTTCCCTAACTTTACACTATTTTTC
ATTAAAACAGAATTTAGACAATTTTTTATTTTTTTCTATTTTGATTGCCTATTTTTAAAT
TAATCTATTATTTAGTATAGAATCCTATTTAAGTGTTTACTTTATTTATAATTAGGTATA
ACAATGCAAATTAATGGAGTTGAAGGATTTTATGTTGCTTACCTTCTTCTTGCTATTTCT
TTTGTATTATCAATTATTGTTTTCTTCTTTACCAAGAAAGACTAAGCTCCTTGTTTCCAA
TGGCTTTTTTCCTTAGGCTCAATATTTGTCGCTATTGCAATTCTTAGTGTTATAGCCTAA
GTCTTAGTAGATTTTATTAACGTAAATTAAATTTAAATTTTCATTTTATACTCACAGTGA
ACTAATTAAATTTTATATATTAGTTTTTCTAGCTTCTCACATCAATGAATAAAACTTTCT
TGGGTATGACTCTTTTAGCCTTAGGAAACTCTGCTACAGGTAAAGCAATAAATTTTAATT
TTTTATTGAGACTAATTAATACAATTATTTAAACAGATTTCTTTACTAATTCATAACTTG
CCAAAGTTGGATATGGTGTTATGGCTTTAACTGGATGCTTTGCTGGACAAGCATTTGATT
TATACCTAGGATTCGGTTTTGCTTTAGTTTTTAGCTCTTATAAGTAAGCTATTTCTTTTT
ATTATTTAAAATATATTTAAAACAATTTAATTTTCTCAATATTAATAGACAAGGATTTGG
TTTATCTATTTTCACAGGCTCTAACATCAATGACTGGTTTAGTAACAGTATTGCTATTAC
AATCTTAGTTTCTGTGATTATTTCAACCATAATTATACTCATATGTTCCATAAAACAAAA
GTAATACTTTTTACCACGAAAACAACCAACCAATTTAATTAATTATTTTAATTTTCAAAT
AAATAGTTACAATTTTGAAAAAGGAAAATTCACCAGCTTTATCAAAAATTACTACTTACT
CATAATTACTATCTGCATAGGTCTCTGTGCAGCTGACTAATTCTTTGAATGA