Identifiers and Description

Gene Model Identifier

TTHERM_000354599

Standard Name

CROP1 (Ciliary Row Organizing Protein 1)

Aliases

None

Description

Sf-assemblin microtubule associated structural protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_000354599

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02355.19.996360612176328e-173hypothetical protein (266 aa)
OxytrichaContig21276.0.g909.99893167504554e-35SF-assemblin/beta giardin
Stentor CoeruleusSteCoe_290016.305116760146989e-16

General Information

Paragraph NoGene NameParagraph Text
106CROP1The IQ-calmodulin motif information given in Gene Browser is based on old information. Recent studies have shown an sf-assemblin domain associated with microtubule structure.

Associated Literature

  1. Ref:SUPR000317

Sequences

>TTHERM_000354599(coding)
ATGTTCTCTCAAACAACTCCTTTTAGAAGAAATTTCGAAAGCCCCGCTAGAGATATCTAC
ACATCGCCTAATCTATCTAAAATAGCTTAATTAAATGAAAGAGTTAAAACTATCCAAACC
AATTTTGAGGAATCTAGAGCTGCCAAAAGAGAAGTATTTTAAAACAAGATGAGATATGTA
GATGATAGAATAAATAAAGTTGAATAATAAAATGATTAAAAGTTTAGATTGCTTGCTGAA
TAGTTGAATAAGATATAAGAAGAAGCTAACTAAGAAACATTGGCTAAAGAAATTCATTCT
GAAAAAAGATTAAAGGAAATTAAGTTGCTGGACAAAAATTTTTCAATCAACATTAGCAAA
GAGCATTAAGAAAAAAAAGAAAATGAAACTAAAATGTTGAGATAAATTGATGAAAAGATA
TAAGAAATGAAGATTGAGCTTTTCCGTGACAGAAAGAAAAGAGAAGATTACGAAGTTTAT
AAGACCAGCGAAATAGAAAATAGAGTTAACGATCTTAGAGAACAATTTGAATAAGAAAAA
AAAATTAGAGATGAAGTATCAGAAAATCTTATTAAAACTTTTGGAGAAGAGATTTTAAAA
TTTTAGGATCTTCTTAGATAAGAAAAGAAAATCAGAGAAGAATAACACAACAATATGCTT
AAAGTTTTAGAAGACTTGAATGATTCTTTAACTTCAGAAGTTACTTAAGAAAAACACATT
AGAGAAAAGTCAGAAGAAATGTTGCTTAAGTTATTAGAAGATACTTGTTAAAAGATTGAA
TCATCTCTTTTGAATTGA


>TTHERM_000354599(protein)
MFSQTTPFRRNFESPARDIYTSPNLSKIAQLNERVKTIQTNFEESRAAKREVFQNKMRYV
DDRINKVEQQNDQKFRLLAEQLNKIQEEANQETLAKEIHSEKRLKEIKLLDKNFSINISK
EHQEKKENETKMLRQIDEKIQEMKIELFRDRKKREDYEVYKTSEIENRVNDLREQFEQEK
KIRDEVSENLIKTFGEEILKFQDLLRQEKKIREEQHNNMLKVLEDLNDSLTSEVTQEKHI
REKSEEMLLKLLEDTCQKIESSLLN


>TTHERM_000354599(gene)
AAAAAGCATAAAAAACAAACAAAAAATAATAATAAATAAATAAATAATTATTTAATAAAA
TAAGTATCTTTTTTCATTATTGTCCAAACAAAATATATTTTAATTAAAAGACAAATTATA
AAAGTAATGTTCTCTCAAACAACTCCTTTTAGAAGAAATTTCGAAAGCCCCGCTAGAGAT
ATCTACAGTAATATTTATATTTAATTCTAGCAAATATATTATTTTAAAAATAACTTTAAT
TTGATTATTTTTATTATGATTATCTTAAAAGCATCGCCTAATCTATCTAAAATAGCTTAA
TTAAATGAAAGAGTTAAAACTATCCAAACCAATTTTGAGGAATCTAGAGCTGTATTTCAT
TTAGATATTTATTGATAAGCTGCCTATTTATTTATATTTTAGCAGCCATTGCACAATTTA
TCACAATTAAAATGGATTCTATAAAATAGGCCAAAAGAGAAGTATTTTAAAACAAGATGA
GATATGTAGATGATAGAATAAATAAAGTTGAATAATAAAATGATTAAAAGTTTAGAGTAA
ATAATTTTATTTAGAATACTCTTTATCTAATTAATTTTGAAAATTAATTTAGTTGCTTGC
TGAATAGTTGAATAAGATATAAGAAGAAGCTAACTAAGAAACATTGGCTAAAGAAGTAAT
AAAAATTATTTAAAGAATTTTGAGAATAAAAAAATAAATAAAGTATTTAGTTGACTAAAT
ACTTTGAAATAGGCTTATAAAATTGAATAATTCTTTGTAAGAAGCTGTAAATGTATTTTA
AATTATTTATATTATAAATTAGATTCATTCTGAAAAAAGATTAAAGGAAATTAAGTTGCT
GGACAAAAATTTTTCAATCAACATTAGCAAAGAGCATTAAGAAAAAAAAGAAAATGAAAC
TAAAATGTTGAGATAAATTGATGAAAAGATATAAGAAATGAAGATTGAGCTTTTCCGTGA
CAGAAAGAAAAGAGAAGATTACGAAGTTTATAAGACCAGCGAAATAGAAAATAGAGTTAA
CGATCTTAGAGAACAATTTGAATAAGAAAAAAAAATTAGGTAAAAAGCTGTTAAAGCATT
AATTAATTAATTAATTATTAGTATTGATTGTATTTATTAAATAAATAAATAAAACCAAAA
TAAAATTTATTAATTGCAAATAGATTAAATGCAACTCATTCATTATTTAAATTCATCAAC
ATAAGTTGATGAAATTATGAAATGCAATTCATATATTAATCTGTACTATGGTTTTATATA
AAAAAAAGAGATGAAGTATCAGAAAATCTTATTAAAACTTTTGGAGAAGAGATTTTAAAA
TTTTAGGATCTTCTTAGATAAGAAAAGAAAATCAGAGAAGAATAACACAACAATATGCTT
AAAGTTTTAGAAGACTTGAATGATTCTTTAACTTCAGAAGTTACTGTAAGAAAAAATATT
TTGTATTTTTTGCTAAAATTAATGAATTTCAATAAATAAATAGTAAGAAAAACACATTAG
AGAAAAGTCAGAAGAAATGTTGCTTAAGTTATTAGAAGATACTTGTTAAAAGATTGAATC
ATCTCTTTTGAATTGA