Identifiers and Description

Gene Model Identifier

TTHERM_00293380

Standard Name

CRN1 (CoRoNin 1)

Aliases

PreTt15548 | 27.m00208 | 3692.m00012

Description

Coronin protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF00904 ) Involucrin repeat
  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF08047 ) histidine operon leader peptide
  • ( PF08953 ) Domain of unknown function (DUF1899)
  • ( PF08954 ) Domain of unknown function (DUF1900)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00293380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08696.19.997093137033517e-262hypothetical protein (825 aa)
SGDYLR429W2.0001081030036656e-67CRN1 Coronin, cortical actin c
ytoskeletal component that ass
ociates with the Arp2p/Arp3p c
omplex to regulate its activit
y; plays a role in regulation
of actin patch assembly
DictyBaseDDB_G02673829.996162112727537e-67corA on chromosome: 1 position
943374 to 944711
OxytrichaContig3627.0.g265.998566275848171e-59Domain of unknown function (DU
F1900)
WormBaseWBGene000007683.9998411574835458e-50locus:cor-1 Coronin-like pro
tein cor-1 status:Confirmed
UniProt:Q21624 protein_id:
CAD27604.1
Stentor CoeruleusSteCoe_197283.3057006267607343e-37

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000073
  2. Ref:SUPR000072

Sequences

>TTHERM_00293380(coding)
ATGGCTCAAAAGTTTAGATTTAGAAATCTTTTCGCAAAATCTCACACAAAGTGGGAGGAC
ATTTAACCTTTAGGTGGTGCTACTGATGGTTATATAATAGCAGGTAACTCTAAGTTCATA
GCTTTCCCCCTTCAAGGTGGTATGGGAAGCACTTTAGGTGTATTAAGCTATAAGCAATCT
GGAAGAGTCAAACAAATTTCTTAAATTAGGGCCCATACTTCTCACATTACTGATTTCAAG
TTTTTGCCTTACTAAGAAAACACTGTAGCTACTGCTTCTTAAGATGCAACCATTAAGTTT
TGGCACATTGATGATGATAATAGCAAAGATATTGACACTCCATTAACTACACTATCTGGA
CATGCTCTTAAAATCAATTTGATTGCTCCCCATAACTCAGCTAAAGGTATATTAGCCTCT
GCATCGTATGACAAGACTATCAAGGTTTGGAATACTGAAGAAAGCAAAGATGTACTTACT
ATTAACTAAGGTAGTAACTATGCTCTTTGCTTAGAGTGGTCCCACGATGGATCAATCCTA
GGTTCTACATGGAATGATAAACAAGTAAGAATTATTGATCCTAGGTAATAAACATTTGTT
AAAGAATTCGGAGCTCATCAAAGCACCAGAGCATAAAAAATGGCCTTTTTAGGTAATACA
AGTTACTTCGTAACTACAGGTTTTGACCAAGTATAAAAGAGATAGCTTTTCCTTTGGGAT
ATTCGTAATACCTCAAGCAATATCAAAGTAGAAGGCTGTTCTTAAGCTTAAGGTGTTCTC
CATCCCTACTATGATAGCGATTTAGGTATTTTATATCTAAATGGTAAAGGTGAAGGCTTA
GTCCGCTTATTTGAATACCAAAACGGAACTCTCACAACTCATTAAAATGATGTCATGGTT
ACTGATACTACTAAGGGATATGGTTTCTTACCTAAGTATGCTGTAGACACACATTAGAAT
GAAGTTTGTAGATTAGTAAAATTATGTAGCAAATACGCTGAAGCAGTTTCTATCATTTAT
CCTAGAAGAAGTTAAGACTTTTAAGAAGATCTCTATCCAGATTGCTCTATTGACTTTAGC
TTGACAGCTCAATAATGGCTTGAAGGTTAAAATGCTTAACCTAAAGTTGCTGCCATGAAG
GATTTAAAGTTGTCTAACCACACTCATCATAGTAAGCCTGCTACTACCACTCACAATTAA
ACTCTTTCTCATCAAGTTCACCATACTACTACCACTACTAATGTTACCCAACCTCAAAGA
AAATCAAGTAATACTTAAACTAGTCATACTACCCATCATGTTAAGACTGAAGCTAAGGTA
GAAGCTATTTCAGAAAAAGAAAATAGTCATCCAAACAATCAACAAGATGTAGAACACTAA
TAATTACAAAAAGCAATCGAAGAAAACAAAGATTATTTAGCTAAAAATGAAAACTTAAAG
AGTGATTTAGCTCAAAAAGATGCCGAAATTACTGAATTAAAGAGCTAAGTTGAGTATTTA
CATCTTTAAGTTTAGGAAAGAATATAGAATGAGTAAAGTGTTAGTGTTTTGACTTAAGAA
GTAGAATAATTAAAACAAAACTTGGTTTAAAGTGAAACCTAAAATACTGAGCTTAAAGAA
TAATTGCAAGCATAAACAGTTACTTTCTAATAAGAAAAAGAATTGCTTAACTTGCAAATT
CAAGAATTTAAATAAAAATATTAAGACTGCATTCAATTAGTATAAACTTTAAGCCAATAA
GAAGTAAGTCTTGAAGGACTTGAGCATGATTAACTTCTTTAATCTCTCAGATCTCTTGCT
GAAAAAGGCGAATAGAACTCTTAACTTTGA


>TTHERM_00293380(protein)
MAQKFRFRNLFAKSHTKWEDIQPLGGATDGYIIAGNSKFIAFPLQGGMGSTLGVLSYKQS
GRVKQISQIRAHTSHITDFKFLPYQENTVATASQDATIKFWHIDDDNSKDIDTPLTTLSG
HALKINLIAPHNSAKGILASASYDKTIKVWNTEESKDVLTINQGSNYALCLEWSHDGSIL
GSTWNDKQVRIIDPRQQTFVKEFGAHQSTRAQKMAFLGNTSYFVTTGFDQVQKRQLFLWD
IRNTSSNIKVEGCSQAQGVLHPYYDSDLGILYLNGKGEGLVRLFEYQNGTLTTHQNDVMV
TDTTKGYGFLPKYAVDTHQNEVCRLVKLCSKYAEAVSIIYPRRSQDFQEDLYPDCSIDFS
LTAQQWLEGQNAQPKVAAMKDLKLSNHTHHSKPATTTHNQTLSHQVHHTTTTTNVTQPQR
KSSNTQTSHTTHHVKTEAKVEAISEKENSHPNNQQDVEHQQLQKAIEENKDYLAKNENLK
SDLAQKDAEITELKSQVEYLHLQVQERIQNEQSVSVLTQEVEQLKQNLVQSETQNTELKE
QLQAQTVTFQQEKELLNLQIQEFKQKYQDCIQLVQTLSQQEVSLEGLEHDQLLQSLRSLA
EKGEQNSQL


>TTHERM_00293380(gene)
AATAAAAATTAAACAAAAAAAAATTACCAACAAAAAAAAGAAGAAAATCAATAATTTTAT
TAAAGCATTTAATTAAGCGGACATTCATTAAAAATGGCTCAAAAGTTTAGATTTAGAAAT
CTTTTCGCAAAATCTCACACAAAGTGGGAGGACATTTAACCTTTAGGTGGTGCTACTGAT
GGTTATATAATAGCAGGTAACTCTAAGTTCATAGCTTTCCCCCTTCAAGGTGGTATGGGA
AGCACTTTAGGTGTATTAAGCTATAAGCAATCTGGAAGAGTCAAACAAATTTCTTAAATT
AGGGCCCATACTTCTCACATTACTGATTTCAAGTTTTTGCCTTACTAAGAAAACACTGTA
GCTACTGCTTCTTAAGATGCAACCATTAAGTTTTGGCACATTGATGATGATAATAGCAAA
GATATTGACACTCCATTAACTACACTATCTGGACATGCTCTTAAAATCAATTTGATTGCT
CCCCATAACTCAGCTAAAGGTATATTAGCCTCTGCATCGTATGACAAGACTATCAAGGTA
AATACTTTAAATTCTTTTTTTAAAATCAGTCATTAATATTACTCTTATAACCTAACATTT
TTAAAATAGCTAATTAACTTTTTTAAATATTAATTTAGGTTTGGAATACTGAAGAAAGCA
AAGATGTACTTACTATTAACTAAGGTAGTAACTATGCTCTTTGCTTAGAGTGGTCCCACG
ATGGATCAATCCTAGGTTCTACATGGAATGATAAACAAGTAATATTATTATTTAAAGTTG
ACTCCTTCATTAATATTAAGAAGCTAGACTTTTATAAGACTTTTATGATGGAATTGATTA
TTCTTTAATGCAGACTATTGATTTAAGGTTAATAAAAATTCTTTTATTTTAAAATAAAAA
TAGGTAAGAATTATTGATCCTAGGTAATAAACATTTGTTAAAGAATTCGGAGCTCATCAA
AGCACCAGAGCATAAAAAATGGCCTTTTTAGGTAATACAAGTTACTTCGTAACTACAGGT
TTTGACCAAGTATAAAAGAGATAGCTTTTCCTTTGGGATATTCGTAATACCTCAAGCAAT
ATCAAAGTAGAAGGCTGTTCTTAAGCTTAAGGTGTTCTCCATCCCTACTATGATAGCGAT
TTAGGTATTTTATATCTAAATGGTAAAGGTGAAGGCTTAGTCCGCTTATTTGAATACCAA
AACGGAACTCTCACAACTCATTAAAATGATGTCATGGTTACTGATACTACTAAGGTAAAA
TATCTTATCAAATTTTATAATAAGAAGATATATCTTAATTGAGAATTTAAAGTACTTTAG
GATTTTATCAATGCTTTTAATATAAAATGAATGAAAACTTATTAGCAATAATTAATCCTT
CAAAGTTTTATATAAATGAATTTAGTTATTTTTGAATGATGAAAATAAATAATCTAAATT
TATAACATGTATACTAACTAATTGCAAATTTATTAAAATTAAAGGGATATGGTTTCTTAC
CTAAGTATGCTGTAGACACACATTAGAATGAAGTTTGTAGATTAGTAAAATTATGTAGCA
AATACGCTGAAGCAGTTTCTATCATTTATCCTAGAAGAAGTTAAGACTTTTAAGAAGATC
TCTATCCAGATTGCTCTATTGACTTTAGCTTGACAGCTCAATAATGGCTTGAAGGTTAAA
ATGCTTAACCTAAAGTTGCTGCCATGAAGGATTTAAAGTTGTCTAACCACACTCATCATA
GTAAGCCTGCTACTACCACTCACAATTAAACTCTTTCTCATCAAGTTCACCATACTACTA
CCACTACTAATGTTACCCAACCTCAAAGAAAATCAAGTAATACTTAAACTAGTCATACTA
CCCATCATGTTAAGACTGAAGCTAAGGTAGAAGCTATTTCAGAAAAAGAAAATAGTCATC
CAAACAATCAACAAGATGTAGAACACTAATAATTACAAAAAGCAATCGAAGAAAACAAAG
ATTATTTAGCTAAAAATGAAAACTTAAAGAGTGATTTAGCTCAAAAAGATGCCGAAATTA
CTGAATTAAAGAGCTAAGTTGAGTATTTACATCTTTAAGTTTAGGAAAGAATATAGAATG
AGTAAAGTGTTAGTGTTTTGACTTAAGAAGTAGAATAATTAAAACAAAACTTGGTTTAAA
GTGAAACCTAAAATACTGAGCTTAAAGAATAATTGCAAGCATAAACAGTTACTTTCTAAT
AAGAAAAAGAATTGCTTAACTTGCAAATTCAAGAATTTAAATAAAAATATTAAGACTGCA
TTCAATTAGTATAAACTTTAAGCCAATAAGAAGTAAGTCTTGAAGGACTTGAGCATGATT
AACTTCTTTAATCTCTCAGATCTCTTGCTGAAAAAGGCGAATAGAACTCTTAACTTTGA