Identifiers and Description

Gene Model Identifier

TTHERM_01299730

Standard Name

CPH4 (homolog of CAP-H or BRN1 condensin gene)

Aliases

PreTt17579 | 315.m00030

Description

condensin subunit, kleisin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02616 ) ScpA/B protein
  • ( PF05786 ) Barren protein
  • ( TIGR01396 ) flagellar basal-body rod protein FlgB
  • ( TIGR00133 ) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_01299730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19650.19.997093137033517e-262hypothetical protein (865 aa)
DictyBaseDDB_G02920665.000468829272308e-18ncapH on chromosome: 6 positio
n 1141212 to 1144129
OxytrichaContig18145.0.g341.000361553249356e-16Condensin complex subunit 2
SGDYBL097W0.0000020007268868677913BRN1 Subunit of the condensin
complex; required for chromoso
me condensation and for cluste
ring of tRNA genes at the nucl
eolus; may influence multiple
aspects of chromosome transmis
sion
Stentor CoeruleusSteCoe_311690.00001670170079024566

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29237819: Howard-Till R, Loidl J (2018) Condensins promote chromosome individualization and segregation during mitosis, meiosis, and amitosis in Tetrahymena thermophila. Molecular biology of the cell 29(4):466-478

Sequences

>TTHERM_01299730(coding)
ATGAATCGTCAGCCAAGGCGTAAAACAGAAAATAACTACAAAGATGTGATAGAGGAAGAA
ATAAACGATTTAGTAACTCATGAAGAAAATGTGTTAAATATAGCAGCTGGAAATAAATTA
AAATTGCAAAATAAAAATTCACGCAAAATTTCAAACGAAATAGATGATGACGAAGAAGAT
GAAGAAATAGATTTCATAGATTCGCAAGATGCAAGTAATGGAGCTGCTGAAAAGTTATAG
CGTGTTTATAGATAGCTATTAAAAAACAAAATTAAGGTAGACAATGTCTTCGATATTTAA
TGGGATGAAAAAACTAAATTAGCAGATTTAGATTGGTAGAGCTCTGCTAATTTCTTAGAT
ACTATTAGTAAAGTTTGGGGCATTAAGGTAGAAAAGACTCATAAAGATACCTATAGAATT
TTGGGAAACCTTATCCGTTCCGAGATCTAAGATCCGGAAGAAGAAGTTGATCCATCAAAA
AAGATAAAAGAAAACTTAGATTTAGCAAAAATATTATCTAAAGCTATTTAAAGACAAACC
AATGACTAATATGGTGCCAAAACACTTGAAAAAAATCCTGATAATTTAGATGTTGTTACA
TACGACATAGAATTTGATGTTGATCCACTCTTTAAAAAAACTTCTGCTAAATTTGACGAG
TAGGGTGCAAGTGGATTACTTATAAATAACCTTTATATGGATTCAAATATGATGCTTATG
CTTGAATCACATCAACCTAATGAGTAAAAGGCTGAAGAAGAGGAGCGTAAAGAAATGTTA
ACATAAAAATCTTTACAATAAAACTTATCTCAAGAGTGCTCTAATTATTGGAGAATTGTA
GATACTAACAATCTCTTTTCTAGCAAATGCTCAATTGCAGAAAGGTTATCAAATTTTAAA
AAACTCCTTACATCTTCAGAAGATGAAAACACTTTAGTTAAATTGAATAATGAAGTTACA
TAGATGAACAGTAAATTAAAGCAAAACTCTTAAAAAACAACAGCTTCTGAATAGAATATA
AGTGCTTAACCTGTAATTGATGAAGTTAGAGTAGATATCTTGAATGATGATGAATTATAA
GCATTATATGATTAAGGAGTAGTTGATCCATTTGGCAAAGATGAGCTTTACGGCTCTAAT
AGATAACAGCTTAGCTGGTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNAAGTGTTATAGAGGCTATTATTGTAGAAGAAAGTGAGGAGGACGAAGAAAAATAAAAA
GCAATAAATGGTGTAGAAGAAGCAGAGGAGAGAAAAGATTAAGAAAAACCAAACAAAAAG
GTGGATGAAGGAGAGGATGAAGAAGACGAAGAAGAAAAAAAACTTAAATAATAAGAATAG
GATGATGAAGATGACAAAAAAGTTGTCTTATTCACTGAAGCTAAAGAAAAGTAAAGTGAT
GAAGAAGATGAAGATAAAGCCAAAAGCGATGAAGAGGATTCCGTAGAAGAAATGGAAGAA
GAGGAAGATGAAGAAGGTAATATAGTTAAGAGAAGAAAAGTTAAGGGTCCCTTAGATTTT
GCAGGAATCGACGAAAAACTTAAAACAGTAGGTAGAGGTATGCATAAGAAATTCAATGAA
GAATTTAATGAGTTACCTCAGCCTAAAACTAACAAGAAGAAGAAGAAAAACAAAAAATCT
GGTGATGATGAGGAAGAAAATAAAAAATATTTCGACTTTAATACTAAAATAACTGAAAAA
GTGGATATCATTTTGGCAAATAAAAAGAAAAGAACTATTAAAGATTATTTAAAAAGTGTT
AAGTTTATATTCGAAGATAAAGATCATTTATTTTTGAGTGATAAAATTTTTATGAAAATG
ACAGAAGGTCTAACTAATCCATTTAATGTTAATGAAATGTACTTAGAAATGAAAAATAAC
AAAAACGAACCTGCAATTAATGAAAATATTTTACCAGAAATCAATATAGATGATAATGAT
GATTCTTTAGATATTAATAATAACTTCAGAAACTTATTTGCTTTAAATTATGGTAATGAT
GAAGAAGACGAAGAAAAATTCAAAGAGCAAAAGAATCATGTTAAAATAAGAGATTTAAAG
AGAAAACTTTGGGACAAATTAAGATCTAAAATTTTAGAAAACCATGCTAATTTCTAGAAG
TAAAAACAAACAAGAAAGAAATAAGAAAAGGAAGAAATGGAATAAATTCAATTCACTAAT
ATGATGACTGAATTACCAAGTATGTTCGGAGAAAGTGCTAAAAGAGTATCAATGCAATCA
TGCTTTATCACAATCTTGCATTTAGCGAATGAATAAACATTAAAATTAAGCAATTAAGAA
GGAGAAGACTTTGGTATAACAAAAGAATCTAAAGCTGACTTGGCACAGGAATTGTTAGAA
TTAAAGAGATAATAAGAATAAGAAGAAGAACAAGAAAAACTCAAAAAGATTGAAGAAGAA
GAAATTAATGAAGATGAAGAAGAAGACCTTTAAAATAGTGGTAAAAAATCTAAAGGTGTA
TCTGATAATTTAAATGGAAATTAAAACATTGAAAAAATGTAGCTAGAGTGA


>TTHERM_01299730(protein)
MNRQPRRKTENNYKDVIEEEINDLVTHEENVLNIAAGNKLKLQNKNSRKISNEIDDDEED
EEIDFIDSQDASNGAAEKLQRVYRQLLKNKIKVDNVFDIQWDEKTKLADLDWQSSANFLD
TISKVWGIKVEKTHKDTYRILGNLIRSEIQDPEEEVDPSKKIKENLDLAKILSKAIQRQT
NDQYGAKTLEKNPDNLDVVTYDIEFDVDPLFKKTSAKFDEQGASGLLINNLYMDSNMMLM
LESHQPNEQKAEEEERKEMLTQKSLQQNLSQECSNYWRIVDTNNLFSSKCSIAERLSNFK
KLLTSSEDENTLVKLNNEVTQMNSKLKQNSQKTTASEQNISAQPVIDEVRVDILNDDELQ
ALYDQGVVDPFGKDELYGSNRQQLSWFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XSVIEAIIVEESEEDEEKQKAINGVEEAEERKDQEKPNKKVDEGEDEEDEEEKKLKQQEQ
DDEDDKKVVLFTEAKEKQSDEEDEDKAKSDEEDSVEEMEEEEDEEGNIVKRRKVKGPLDF
AGIDEKLKTVGRGMHKKFNEEFNELPQPKTNKKKKKNKKSGDDEEENKKYFDFNTKITEK
VDIILANKKKRTIKDYLKSVKFIFEDKDHLFLSDKIFMKMTEGLTNPFNVNEMYLEMKNN
KNEPAINENILPEINIDDNDDSLDINNNFRNLFALNYGNDEEDEEKFKEQKNHVKIRDLK
RKLWDKLRSKILENHANFQKQKQTRKKQEKEEMEQIQFTNMMTELPSMFGESAKRVSMQS
CFITILHLANEQTLKLSNQEGEDFGITKESKADLAQELLELKRQQEQEEEQEKLKKIEEE
EINEDEEEDLQNSGKKSKGVSDNLNGNQNIEKMQLE


>TTHERM_01299730(gene)
ATGAATCGTCAGCCAAGGCGTAAAACAGAAAATAACTACAAAGATGTGATAGAGGAAGAA
ATAAACGATTTAGTAACTCATGAAGAAAATGTGTTAAATATAGCAGCTGGAAATAAATTA
AAATTGCAAAATAAAAATTCACGCAAAATTTCAAACGAAATAGATGATGACGAAGAAGAT
GAAGAAATAGATTTCATAGATTCGCAAGATGCAAGTAATGGAGCTGCTGAAAAGTTATAG
CGTGTTTATAGATAGCTATTAAAAAACGTAAAAATTTAGAGAATAGATAAAAAACCATTA
AATAAAATATTTAATCTACTTTTAAAGTAGAAAAATAAAAGCATTCAAATGTTAAAATAG
CATTTAAATGCATAAACATGACAGAATCAATAGACAAATAGTTGTTTTAAGAAATACATT
TTAATTTACTTTCTAAAATAAATAGAAAATTAAGGTAGACAATGTCTTCGATATTTAATG
GGATGAAAAAACTAAATTAGCAGATTTAGATTGGTAGAGCTCTGCTAATTTCTTAGATAC
TATTAGTAAAGTTTGGGGCATTAAGGTAGAAAAGACTCATAAAGATACCTATAGAATTTT
GGGAAACCTTATCCGTTCCGAGATCTAAGATCCGGAAGAAGAAGGTATAAATTTTTTTAG
TATTTAATAAGGAGCTAGCAAATAATATCTAACAAAGGGTAGAGTATATATTTTAGACAC
GTATTTTATTTTACCTTCCTACTCTACTTCTGTGTAAATATATGCCTATGTGATAATCTT
CATCTTTTCTTACTGCAGAATAAAATTTACTAAAGATATATTTAAATTTATTTTATGTAG
ATTAACTGATAAAAATAATTTGAAAAAGGGGTTAATATTTATGATATATTTTTATCAATA
AATTTGAAATGCTTTACTTACTTACTTACAAATAAATGACTTAAAACAAAGAAAGCTCTT
AAAAGAAGCATATTATGAGAATAAATATACATATTATCATTATTTATTTTTATTATCAAA
AAAGTTGATCCATCAAAAAAGATAAAAGAAAACTTAGATTTAGCAAAAATATTATCTAAA
GCTATTTAAAGACAAACCAATGACTAATATGGTGCCAAAACACTTGAAAAAAATCCTGAT
AATTTAGATGTTGTTACATACGACATAGAATTTGATGTTGATCCACTCTTTAAAAAAACT
TCTGCTAAATTTGACGAGTAGGGTGCAAGTGGATTACTTATAAATAACCTTTATATGGAT
TCAAATATGATGCTTATGCTTGAATCACATCAACCTAATGAGTAAAAGGCTGAAGAAGAG
GAGCGTAAAGAAATGTTAACATAAAAATCTTTACAATAAAACTTATCTCAAGAGTGCTCT
AATTATTGGAGAATTGTAGATACTAACAATCTCTTTTCTAGCAAATGCTCAATTGCAGAA
AGGTTATCAAATTTTAAAAAACTCCTTACATCTTCAGAAGATGAAAACACTTTAGTTAAA
TTGAATAATGAAGTAAATAGACATTCAAGATTAAAATGGTTAAATATTTTCTATTTAAAA
AGGTTACATAGATGAACAGTAAATTAAAGCAAAACTCTTAAAAAACAACAGCTTCTGAAT
AGAATATAAGTGCTTAACCTGTAATTGATGAAGTTAGAGTAGATATCTTGAATGATGATG
AATTATAAGCATTATATGATTAAGGAGTAGTTGATCCATTTGGCAAAGATGAGCTTTACG
GCTCTAATAGATAAGTACGATTTTATTTGTTAAGAAAAGTTTTATTAATTTTTTATTAGA
AAACAAGCAGCTTAGCTGGTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNAAGTGTTATAGAGGCTATTATTGTAGAAGAAAGTGAGGAGGACGAAGAAAAATAAAA
AGCAATAAATGGTGTAGAAGAAGCAGAGGAGAGAAAAGATTAAGAAAAACCAAACAAAAA
GGTGGATGAAGGAGAGGATGAAGAAGACGAAGAAGAAAAAAAACTTAAATAATAAGAATA
GGATGATGAAGATGACAAAAAAGTTGTCTTATTCACTGAAGCTAAAGAAAAGTAAAGTGA
TGAAGAAGATGAAGATAAAGCCAAAAGCGATGAAGAGGATTCCGTAGAAGAAATGGAAGA
AGAGGAAGATGAAGAAGGTAATATAGTTAAGAGAAGAAAAGTTAAGGGTCCCTTAGATTT
TGCAGGAATCGACGAAAAACTTAAAACAGTAGGTAGAGGTATGCATAAGAAATTCAAGTA
AAACTAATTAAAAATAAAACTTTAAATTGAGTAAATTTTAAATTGTTTTTTATTCTTTTA
GTGAAGAATTTAATGAGTTACCTCAGCCTAAAACTAACAAGAAGAAGAAGAAAAACAAAA
AATCTGGTGATGATGAGGAAGAAAATAAAAAATATTTCGACTTTAATACTAAAATAGTAA
TTAAGAAACATAAAATTATTTTTTTTCTTTATTATTTTTTTATGCTAATAAAACAAACAG
ACTGAAAAAGTGGATATCATTTTGGCAAATAAAAAGAAAAGAACTATTAAAGATTATTTA
AAAAGTGTTAAGTTTATATTCGAAGATAAAGATCATTTATTTTTGAGTGATAAAATTTTT
ATGAAAATGACAGAAGGTCTAACTAATCCATTTAATGTTAATGAAATGTACTTAGAAATG
AAAAATAACAAAAACGAACCTGCAATTAATGAAAATATTTTACCAGAAATCAATATAGAT
GATAATGATGATTCTTTAGATATTAATAATAACTTCAGAAACTTATTTGCTTTAAATTAT
GGTAATGATGAAGAAGACGAAGAAAAAGTATATTCTTTTTTATTTATTTATTTATTTATT
TATTTATTTATTTATTTCAAATTCAGACATTCATTAAATGTTTCTTAATTTTTTATTATA
GTTCAAAGAGCAAAAGAATCATGTTAAAATAAGAGATTTAAAGAGAAAACTTTGGGACAA
ATTAAGATCTAAAATTTTAGAAAACCATGCTAATTTCTAGAAGTAAAAACAAACAAGAAA
GAAATAAGAAAAGGAAGAAATGGAATAAATTCAATTCACTAATATGATGACTGAATTACC
AAGTATGTTCGGAGAAAGTGCTAAAAGAGTATCAATGCAATCATGCTTTATCACAATCTT
GCATTTAGCGAATGAATAAACATTAAAATTAAGCAATTAAGAAGGAGAAGACTTTGGTAT
AACAAAAGAATCTAAAGCTGACTTGGCACAGGAATTGTTAGAATTAAAGAGATAATAAGA
ATAAGAAGAAGAACAAGAAAAACTCAAAAAGATTGAAGAAGAAGAAATTAATGAAGATGA
AGAAGAAGACCTTTAAAATAGTGGTAAAAAATCTAAAGGTGTATCTGATAATTTAAATGG
AAATTAAAACATTGAAAAAATGTAGCTAGAGTGA