Identifiers and Description

Gene Model Identifier

TTHERM_00554600

Standard Name

CPH3 (homolog of CAP-H or BRN1 condensin gene)

Aliases

PreTt29267 | 72.m00190

Description

condensin subunit, kleisin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00554600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07309.19.997093137033517e-262hypothetical protein (774 aa)
OxytrichaContig18145.0.g342.998577119979921e-31Condensin complex subunit 2
DictyBaseDDB_G02920667.996806159126539e-24ncapH on chromosome: 6 positio
n 1141212 to 1144129
SGDYBL097W0.00000000000004998767099442072BRN1 Subunit of the condensin
complex; required for chromoso
me condensation and for cluste
ring of tRNA genes at the nucl
eolus; may influence multiple
aspects of chromosome transmis
sion
Stentor CoeruleusSteCoe_311690.0000000001026187963170189

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29237819: Howard-Till R, Loidl J (2018) Condensins promote chromosome individualization and segregation during mitosis, meiosis, and amitosis in Tetrahymena thermophila. Molecular biology of the cell 29(4):466-478

Sequences

>TTHERM_00554600(coding)
ATGGGTAAACCTTTAAGCGAGAAGCAAGTGAATTCATCCTAAAATTCACAAAATGCCCCT
AACTCGAGGGAAAAGTTTTTAGGAGCAAGCAAAAAAATAGCTAAAAAAAAGAAGGAAGTT
TCGCTGGACTTAGAAACCAATTAGGAAGAAGGGTTAGATTCCTTGAAGCTGCAATAGCAA
TCCAAGAAAGAAACATCAAAAGAAATAATATAAAGAAGGTAGAATTTATATGATAGGGAA
GAAGATGAGGAAATAGAAGAGGAATACAACATTGAAGATGCAAAATTGGCTAAAAACTCT
AATTAAGATAAAATCAGCGACATAATTGTAGGCCTTTTGTTAAAAAACAAAATCAACTCA
AAAAATGCATTTGAAGTCCCTGTTGTAAATGTTTTAGATCTCTCTGATTTTAAAAACATA
AATACAGATTTTGCTTGGAAGAAGCTCTCAAGCACTCTTGATGCAGGTGCAAGGATTTAT
GGATATCGTGTAGACAGTTTGCATAGTGACACTTATAAAATAAGAGGAGGCCTTAATCGC
TCAGAGGTTTAAGACATAAAAGATGCTAATAAAGCAAATGATTTAGAAGACCCACTTGAA
AAAGATGAAGAAATAGAAAAGAAATTGCAAAAGAAGAAATTCAAAGGAGGTGAGAGCACT
TTAGAAAAGAACTTAGCGAATATCAATGCCACCAAATACGATTTAGAATTCGACATTGAT
CCTCTATTTCAAAAAACCTCTGCAAAATTTGATGACTCAGGAGCTAAAGGACTTCTTATG
AATGCTATAGGAATAGATTCTGATGTCTCAATTTTGCTTGACTCATCTAAGCAGTAGCAA
CTTTGGAAGAGAAGAAAGCAAAAAAAAGCAACTTATGGTGAAATAGCAAGTTTAAATAGT
GGTAAACCAACAAATTATGAGAGTATCTTTAAGTGCTAGCTTTGTCCCGAAATGACTAAT
TTGGCTCTAGACATGAGAAATAATTCAAAGCAGATCTTTGATGTGTCAAGAATAAGAGAA
AACAGGAGAACAAACTTCTTGATTTCTACAAACTCTGAAATTTCAATGTAAAATAAGCTT
ATAAACGAAATAGAAGAAGGTGAGAGAGAAATCATGCAAGAAATTGATGCAGCTATTTTG
AATTAGGTTGATGATTATTTAGAACCTCTTGAAAAAGAGTAAATACTCTTATAAGATAAT
CCTGCTTCATTCAATGCTGCAAATCTTTCAAACAGCTTTAATCATAACTTGATAACCACC
AATCCTCATGGATACGACGACTACAACGATTAAATAATTCCAGAGTAAGATGATATTCCT
CTTGAAGATGTATATAACGAAAAGAATGCATTAAACCTTGACAAATTCAATTCAATCGAA
GAAGAGCATGACAATACAATTACAGCATTAATTGGCGGAGGAGCTGCCACACTCAACACA
TCTATGAACTCACAGTCTATGAAGCCCCTTAACTTTTTGAATTTAGAAGATAAGTTGCAG
ACAATTGGATTTGGGAAAGAATATATGAATGGATCAAGCATAAAGAATTGGATGCAACCT
GATGCATGGAAATTACCAAAAAAGTAAAACATCAAAATACGCATTTAGGACTTACTCCCA
GAGCTTAACATATTCAGGTCAAAAAAGCTAAAACAAAAGGGTGAGTGCGAAATTGACTTC
GACATCTCAAATGAAGAAGACTTTGATCAAGTTGTTGATCCCGATCCAATTAATGTAGAT
AAATATAAGAGTTCATATTCTTAAGAAATTGGGATGCTCCCAAAAGATTATCACATCTCT
AAGCAATTATTGAGCTCTTTTGGATTTAAAGATCCTGCTACCATATTCCATCGCTCTCGT
CTTGGAAGTGAATTAGATGAAGATGATCTAAATAACGACACAATTGACTACTACGATTAC
AACGGTGATAACAGAATATTGCCTGTAAATACCCATGTTCCCAGTACTATGTCAAAAGTG
CTGAATGAAATTGCAGAAAAATAGGCAATTAAGGCAAAGAACTAAATGCCCATCAAAGAG
CTCAAGACAAAACTATGGGACAAGCTGGAAAAAAAGATACCAATGACTTCAACCACAGGA
TAGAGCCAAAACGACTCTCTTTTCATCCAAAAAAGAGTTGAAGTTGAGGAAGAAGAAATT
CATTTTAGTGATGTTTACGATCAACTCCCTGACTTGATAGGCCTTCAAAATCGTAGCAGA
GTCTCTCTCTAAACATGCTTCGTTACAATTCTTCATCTTGCAAACGAAAAGACTCTCCGT
TTCGAGAGAACTGAGAGAGAAGGTGATTTCAAAATATCAAGAGACTAGAATTGA


>TTHERM_00554600(protein)
MGKPLSEKQVNSSQNSQNAPNSREKFLGASKKIAKKKKEVSLDLETNQEEGLDSLKLQQQ
SKKETSKEIIQRRQNLYDREEDEEIEEEYNIEDAKLAKNSNQDKISDIIVGLLLKNKINS
KNAFEVPVVNVLDLSDFKNINTDFAWKKLSSTLDAGARIYGYRVDSLHSDTYKIRGGLNR
SEVQDIKDANKANDLEDPLEKDEEIEKKLQKKKFKGGESTLEKNLANINATKYDLEFDID
PLFQKTSAKFDDSGAKGLLMNAIGIDSDVSILLDSSKQQQLWKRRKQKKATYGEIASLNS
GKPTNYESIFKCQLCPEMTNLALDMRNNSKQIFDVSRIRENRRTNFLISTNSEISMQNKL
INEIEEGEREIMQEIDAAILNQVDDYLEPLEKEQILLQDNPASFNAANLSNSFNHNLITT
NPHGYDDYNDQIIPEQDDIPLEDVYNEKNALNLDKFNSIEEEHDNTITALIGGGAATLNT
SMNSQSMKPLNFLNLEDKLQTIGFGKEYMNGSSIKNWMQPDAWKLPKKQNIKIRIQDLLP
ELNIFRSKKLKQKGECEIDFDISNEEDFDQVVDPDPINVDKYKSSYSQEIGMLPKDYHIS
KQLLSSFGFKDPATIFHRSRLGSELDEDDLNNDTIDYYDYNGDNRILPVNTHVPSTMSKV
LNEIAEKQAIKAKNQMPIKELKTKLWDKLEKKIPMTSTTGQSQNDSLFIQKRVEVEEEEI
HFSDVYDQLPDLIGLQNRSRVSLQTCFVTILHLANEKTLRFERTEREGDFKISRDQN


>TTHERM_00554600(gene)
ATGGTAGGTTTATTTATTTTAAATGATATTCAAAACAAATAGGACCTTTTATTTTCTAAA
AACTATAGGGTAAACCTTTAAGCGAGAAGCAAGTGAATTCATCCTAAAATTCACAAAATG
CCCCTAACTCGAGGGAAAAGTTTTTAGGAGCAAGCAAAAAAATAGCTAAAAAAAAGAAGG
AAGTTTCGCTGGACTTAGAAACCAATTAGGAAGAAGGGTTAGATTCCTTGAAGCTGCAAT
AGCAATCCAAGAAAGAAACATCAAAAGAAATAATATAAAGAAGGTAGAATTTATATGATA
GGGAAGAAGATGAGGAAATAGAAGAGGAATACAACATTGAAGATGCAAAATTGGCTAAAA
ACTCTAATTAAGATAAAATCAGCGACATAATTGTAGGCCTTTTGTTAAAAAACGTAATAC
ATATTTCTTATAAATTCAAATTTTAGAATTTTTTGTTAGCTTTGTTTTTTTTCTTGTCAT
TCATCAAAAATCTTATTATCATTAAAGAAAATCAACTCAAAAAATGCATTTGAAGTCCCT
GTTGTAAATGTTTTAGATCTCTCTGATTTTAAAAGTAAGCATTGTTTTTATGAGGAAGAA
ATACTTCTTCTAAAACACATATTTTTAATATAATTTTTGTTAAAAAAGACATAAATACAG
ATTTTGCTTGGAAGAAGCTCTCAAGCACTCTTGATGCAGGTGCAAGGATTTATGGGTATG
CTAATTAACGGATTTTAATTTTAATAATATTTAAATACAAACAAAAGATATCGTGTAGAC
AGTTTGCATAGTGACACTTATAAAATAAGAGGAGGCCTTAATCGCTCAGAGGTTTAAGAC
ATAAAAGGTAGTTAAGTTATTTATACATTATATAGTTGATTCTATAATAATATATATTAT
ATAGATGCTAATAAAGCAAATGATTTAGAAGACCCACTTGAAAAAGATGAAGAAATAGAA
AAGAAATTGCAAAAGAAGAAATTCAAAGGAGGTGAGAGCACTTTAGAAAAGAACTTAGCG
AATATCAATGCCACCAAATACGATTTAGAATTCGACATTGATCCTCTATTTCAAAAAACC
TCTGCAAAATTTGATGACTCAGGAGCTAAAGGACTTCTTATGAATGCTATAGGAGTATTT
ATTATTAAAATTTCAAATTATAAGAAAAATGAATAACAATGAAATAATCTTTAAAATAGA
TAGATTCTGATGTCTCAATTTTGCTTGACTCATCTAAGCAGTAGCAACTTTGGAAGAGAA
GAAAGCAAAAAAAAGCAACTTATGGTGAAATAGCAAGTTTAAATAGTGGTAAATAAAACT
AATAAGCAAATAATCGCTATGTATTTATTCTGAATTTTTTTTATCTAGGTAAACCAACAA
ATTATGAGAGTATCTTTAAGTGCTAGCTTTGTCCCGAAATGACTAATTTGGCTCTAGACA
TGAGAAATAATTCAAAGCAGATCTTTGATGTGTCAAGAATAAGAGAAGTAAAATAAATTA
TTTCAAAATATTAACATGATTAAATTGCTTAAAATTAATTTTATACAAATGCATTTATTT
GACTTATTTTTAAAATAATTTCCAGAACAGGAGAACAAACTTCTTGATTTCTACAAACTC
TGAAATTTCAATGTAAAATAAGCTTATAAACGAAATAGAAGAAGGTGAGAGAGAAATCAT
GCAAGAAATTGATGCAGCTATTTTGAATTAGGTTGATGATTATTTAGAACCTCTTGAAAA
AGAGTAAATACTCTTATAAGATAATCCTGCTTCATTCAATGCTGCAAATCTTTCAAACAG
CTTTAATCATAACTTGATAACCACCAATCCTCATGGATACGACGACTACAACGATTAAAT
AATTCCAGAGTAAGATGATATTCCTCTTGAAGATGTATATAACGAAAAGAATGCATTAAA
CCTTGACAAATTCAATTCAATCGAAGAAGAGCATGACAATACAATTACAGCAGTAGAGAA
TATTTTTAATTTCTTAACTTTTAACAATGCTAAATAAATAAATTAATAAATAATTCAAAT
AAAAAGTTAATTGGCGGAGGAGCTGCCACACTCAACACATCTATGAACTCACAGTCTATG
AAGCCCCTTAACTTTTTGAATTTAGAAGATAAGTTGCAGACAATTGGATTTGGGAAAGAA
TATATGAATGGATCAAGCATAAAGAATTGGATGCAACCTGATGCATGGAAATTACCAAGT
AATTCAAACCTCTATTTTAATTTTATTAAACAAATAGAGATATTCCTATCCTCATTCATC
AAAAAATTTATGGGGCAGGTCTTTCTTAAAATAAAAATAAAGTTTTAATATTTGTCTATT
CCACGAGGAATAATATGATCGGAACCTGATTAGGTGTTTTTAATTAGAATTTATAAGAAA
ACTCATAGAAATTTTGTGAAAGAATTTATCATTAACACTTTAATCAAAGAGCGATTTTAT
TTTTAATACTTCACAATTTATAAAAAGAAAAGTAAAACATCAAAATACGCATTTAGGACT
TACTCCCAGAGCTTAACATATTCAGGTCAAAAAAGCTAAAACAAAAGGGTGAGTGCGAAA
TTGACTTCGACATCTCAAATGAAGAAGACTTTGATCAAGTTGTTGATCCCGATCCAATTA
ATGTAGATAAATATAAGAGTTCATATTCTTAAGAAATTGGGATGCTCCCAAAAGATTATC
ACATCTCTAAGCAATTGTAATTAATTCATTTTTGTCATTTGGTACCTTAACTTAATTTGC
TTGTGTTTGCTTAATTATTTTGAGGGGTATCGAGATTATTAATTAATTTTTATTTGTGAT
TTGTATCTAGATAATTTGTTCATCTAAGATTCGCAATTGTTTTTATAATTCAAAAGCATT
ACTTTTGCAATTAATTTTTAATCTATTATGATTGACAAGTTGCTTTAGATTAAGATTAAT
AAATTTCTTTTCTTTTTTTCAGGGTACTTTCCTTACATTAATTAAGATATAATTTTTATG
ATGCTTTATTAGAAAAATATCCTAGCATACACACCTTAACCCAACCCAGAACAATTCAAC
ACAACAATTTTTGAAAAAGATATTTTTATGAGTTCAAATAATTTTATATTTTAATTGAAA
AAATAGATTGAGCTCTTTTGGATTTAAAGATCCTGCTACCATATTCCATCGCTCTCGTCT
TGGAAGTGAATTAGATGAAGATGATCTAAATAACGACACAATTGACTACTACGATTACAA
CGGTGATAACAGAATATTGCCTGTAAATACCCATGTTCCCAGTACTATGTCAAAAGTGCT
GAATGAAATTGCAGAAGTAAGATAAATTGATTAATCATTTATAGTTACATATTTATTGTT
GTATATTGATTTTCAAAATTAGTTAAGCAAATTTGAGTTTACATTTTATAAAAAAAATGA
AGTATTGTTGTTCATTAAAATAATTTGTTTCCTTATCCATTAAAGAAATAGGCAATTAAG
GCAAAGAACTAAATGCCCATCAAAGAGCTCAAGACAAAACTATGGGACAAGCTGGAAAAA
AAGATACCAATGGTAAAAATACAAGAAATTATTTTCCAACTTGATTTGTTTGTTTGTTTG
TTAGTTATTTTTTTTTTCTTATTGACTTTCCCCAATTTATAAATTAAAATATCTAAAAGC
CCAAATTATTTGCTATTTTATTTTTTAACCACAAATTTTCACTTTGTTATTCTAATTGAA
GTTGATTTTTCAATTTTATAAAAATAAATAAAATTTTGTTTAATTCAGATAACATTTACA
TACATACCTACAATCAATTGATTTTCGGCTATATTCAAGCTAAAATTCATTTGAATATTT
ATTTATTTATCAATAAAGACTTCAACCACAGGATAGAGCCAAAACGACTCTCTTTTCATC
CAAAAAAGAGTTGAAGTTGAGGAAGAAGAAATTCATTTTAGTGATGTTTACGATCAACTC
CCTGACTTGATAGGCCTTCAAAATCGTAGCAGAGTCTCTCTCTAAACATGCTTCGTTACA
ATTCTTCATCTTGCAAACGAAAAGACTCTCCGTTTCGAGAGAACTGAGAGAGAAGGTGAT
TTCAAAATATCAAGAGACTAGAATTGA