Identifiers and Description

Gene Model Identifier

TTHERM_00540340

Standard Name

CPH2 (homolog of CAP-H or BRN1 condensin gene)

Aliases

PreTt12192 | 70.m00188 | 3728.m00085

Description

condensin subunit, kleisin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05786 ) Barren protein
  • ( PF04394 ) Protein of unknown function, DUF536
  • ( TIGR00690 ) DNA-directed RNA polymerase, omega subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00540340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18236.19.997093137033517e-262hypothetical protein (975 aa)
OxytrichaContig18145.0.g340.000000000000020000882446601127Condensin complex subunit 2
SGDYBL097W0.000030009396760408108BRN1 Subunit of the condensin
complex; required for chromoso
me condensation and for cluste
ring of tRNA genes at the nucl
eolus; may influence multiple
aspects of chromosome transmis
sion
DictyBaseDDB_G02920660.00007000107212225429ncapH on chromosome: 6 positio
n 1141212 to 1144129

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29237819: Howard-Till R, Loidl J (2018) Condensins promote chromosome individualization and segregation during mitosis, meiosis, and amitosis in Tetrahymena thermophila. Molecular biology of the cell 29(4):466-478

Sequences

>TTHERM_00540340(coding)
ATGAATGCAAACAAAAAGCAAACAAAAATTAGAAGGGCAAAAAGCACTTTGAAGAGTTCT
AGAAAGGAAAAATATAGCATAGAAGATTTAGAAACAGAAAAGGAAAGTAACATATCATCT
TATGATCTTGATTATTAGGATGATATTTGGGAGATTAATTCTAATTAAAAAGCAGCTGAA
ATATCTTTTTCTTAGAAAAAAAATGTAAGTGTGAATAGCAGTCTTAAAGGGAGAAATAAT
AGTCAGCTAGTTAAATCTGACGATTTAGCTATGAAGACTTCTAATAAACCTATCAGGAGA
GTTAACACAAGCATAAGCATGAGTTAGAGCTCTGTATAAATATAGGATGAAAGCATAGAT
TTGGATGCTGAAAGCGATCAAGAAAGTGATGATGATTCACATCTCACTCCAGAATAAAAA
TAACTAAAAGATAGATGGCTTCAAATATTCCAAAAAATATCTAAAAGTAGAATAAAGACG
GATGAAGCTTTTGATTTTGATGTAGAATAGGAACTTTAATTAGTTTTGTATGAGTGGAAA
GACTCAGGATGTATATTAGAGTGTATTTCCAAGCTCTATTCTATGAAAGTTGATAGACTA
TCAAAAGAGGCTTATCATTTATTAGCATGTATAGCAAGAGGATAAATAGGTGGAGACAAG
AGTAAAGAAATGGAAAATGAAGAATAAGAGGATGAAAGCAAGAATGAAGGAAATAAATAA
GACAGAAACGATTAAAAAAAAAAGATAGTTTCATTTGAAGAAAAATAAATCTAACAAGGA
TCTTTTGAAAATTTTGATCCGTTTATTGCTGGTTAAAAGCAGATAGAAAAGCCAGAAAAA
TTAATTGTTGATAAGTATGATATTCTTTTTGATCTAGATCCTCTATTTAGGAAGAAAAGC
TAGTATTTTGACGATACTAGCTCGGAAGGTCTTCTTCTTAATGTACTGGAAGTAGATAAA
GAGCTTTGTATAAATTTGTCTGAATTAGATGAGGCATTGGGCAAATAGTAAAAATTAGTT
TAAAGAGATTAAAAAAAATAGACTAAGTCAAATTATATGAAATTATTCACTTAAGAAGAA
TTTAAAAATAAATTCTCAGCTCCTGTTGAAGATTAGATTATCGATTTATTTCCAGAATTA
ATTGATTTTAAGATGTCAGTGATTGACGAAGTTTCTTAATAATTGCTATTTGATAATATT
TAAAGTTTAAACTCTGAGAATGATATTAAGATTCTAACTCAAAATAATAAAAAAATGGAA
ATCATGGATGAAAATTCTGCTTCTATAGTCAATTAAGTGCTTTAAAATGAGAATGATAAA
ATTTTATTAAACGAAATAAACCTAGCATATTAAATGAATGCTTTTACCTCATAAAATTTT
ATGTACAGAAACCTGAGTGACGATTCATTGTTTCAAAATGCATCTCAGTCTTCATAAAAC
AAAGAAGATTTTATTTTATCATAAATGTCTTAAAGTTACACGCCTGATAACAGTATTTTT
AAGAACACAAAGCAGATAAGATTCGATTTGAATGACGAATACTAAGGTTTTGATTCTTCA
AATGACTATGCAAATTATCATGATGAAAATCCATCAACTTAAGAAACAAAGCAAATTGAT
AATTCTTTACTTCATAATTCTTTAAACAAAGTAGGAGGAGGAGATAAAACAATATTCTCT
AATTTTCTCATGAATTTAAATTGGGGAGACCCTAAGCAATGGGATATACAAAAGCTGAGT
GCTAATAAAAGGAAAAAAATACGTTCAAAAAAATTGTAAGATGATCTATTACTTGGAGAG
ATAAAGGAAGATATGGAAGCTGAAGAATAAAATGAAAACATAGCCATGAATAACCAGTAT
GAAAGATTAACGAAGCCACAAAAATATATTGATTTTAGCCTAAATAATGGAAAAGAAGAA
AGCTATAAAGAAGTAATAGGCAAGAAATTTTAGAGATATAAGAGTAATTTAGGATTAAAA
TATGTAAAAATAAAGTAGAAAAGTACTATTCAAAAAGATTATAAAATTACCAGTGAGCAA
GTATTCTAAATAGGTTTAAAATACATAGAAAATACAAAATAAAGTAGAATAAAGGAATTT
ACTAGTGAATATGACAGTTAATTTGATATATTTTAGTAGAGCTAATAGAATTAAAATACA
AGCTAAAATGCTATTAATTAAAATGATGAATATTAAAATGAGTACGAAGCTATTGGCTTT
GATGATTTATATGATGAAATGGATGATAGATTTTACAATCCTTAGAAGTATAATAATTAA
AGAGATAATAGATTTTTTAACACACAAAGAGAAGGCTAAAGTCAATTTGATATTTAAATG
AATAACTCACCATACGGAAGATATCAATACCCTTTCTCTGCTAATAATAATTCACAAAGT
CTCTACACTCAAAATAAAACCCAAAACTTTTTTTCATAAACTATAAAAAGAAAGCCTGTG
AGAATTAGAGATTTAAAAGAAACAGTATGGTAGACTATGACTTAATAGAAGAGCAAAGAA
AATAACAGCTAATTAACCTAATTAAGTTAAATTGTATAAGAAAATTAAAATAAAAGAGGA
AAAAGAAAAAATAAAGCCAAGCTATCTGAAAATGAAGAATAGGAGTAAATTGAAAGTGCG
ATTACTCAAATTAATAGTGAAGATGTTTCTCTCAAGTTTAGTGATTTAATGCATTAATTA
CCAAATTCTCTTGGATAAGATAATTAAGCTTAGGGAGTTTCAGTCTAGAATTGCTTTATT
AGCATACTGCATTTGGCAAACGAAAAACATCTTAGACTTGTTGATCCAAGTCACACTGAG
TTAGAATTTTTTATTTTCTTGGATTAAACATTACAAGAAAATGAAAACTCATAAAACCTT
AGACGAAGCAAAATTTAAGAATCTTGA


>TTHERM_00540340(protein)
MNANKKQTKIRRAKSTLKSSRKEKYSIEDLETEKESNISSYDLDYQDDIWEINSNQKAAE
ISFSQKKNVSVNSSLKGRNNSQLVKSDDLAMKTSNKPIRRVNTSISMSQSSVQIQDESID
LDAESDQESDDDSHLTPEQKQLKDRWLQIFQKISKSRIKTDEAFDFDVEQELQLVLYEWK
DSGCILECISKLYSMKVDRLSKEAYHLLACIARGQIGGDKSKEMENEEQEDESKNEGNKQ
DRNDQKKKIVSFEEKQIQQGSFENFDPFIAGQKQIEKPEKLIVDKYDILFDLDPLFRKKS
QYFDDTSSEGLLLNVLEVDKELCINLSELDEALGKQQKLVQRDQKKQTKSNYMKLFTQEE
FKNKFSAPVEDQIIDLFPELIDFKMSVIDEVSQQLLFDNIQSLNSENDIKILTQNNKKME
IMDENSASIVNQVLQNENDKILLNEINLAYQMNAFTSQNFMYRNLSDDSLFQNASQSSQN
KEDFILSQMSQSYTPDNSIFKNTKQIRFDLNDEYQGFDSSNDYANYHDENPSTQETKQID
NSLLHNSLNKVGGGDKTIFSNFLMNLNWGDPKQWDIQKLSANKRKKIRSKKLQDDLLLGE
IKEDMEAEEQNENIAMNNQYERLTKPQKYIDFSLNNGKEESYKEVIGKKFQRYKSNLGLK
YVKIKQKSTIQKDYKITSEQVFQIGLKYIENTKQSRIKEFTSEYDSQFDIFQQSQQNQNT
SQNAINQNDEYQNEYEAIGFDDLYDEMDDRFYNPQKYNNQRDNRFFNTQREGQSQFDIQM
NNSPYGRYQYPFSANNNSQSLYTQNKTQNFFSQTIKRKPVRIRDLKETVWQTMTQQKSKE
NNSQLTQLSQIVQENQNKRGKRKNKAKLSENEEQEQIESAITQINSEDVSLKFSDLMHQL
PNSLGQDNQAQGVSVQNCFISILHLANEKHLRLVDPSHTELEFFIFLDQTLQENENSQNL
RRSKIQES


>TTHERM_00540340(gene)
ATGAATGCAAACAAAAAGCAAACAAAAATTAGAAGGGCAAAAAGCACTTTGAAGAGTTCT
AGAAAGGAAAAATATAGCATAGAAGATTTAGAAACAGAAAAGGAAAGTAACATATCATCT
TATGATCTTGATTATTAGGATGATATTTGGGAGATTAATTCTAATTAAAAAGCAGCTGAA
ATATCTTTTTCTTAGAAAAAAAATGTAAGTGTGAATAGCAGTCTTAAAGGGAGAAATAAT
AGTCAGCTAGTTAAATCTGACGATTTAGCTATGAAGACTTCTAATAAACCTATCAGGAGA
GTTAACACAAGCATAAGCATGAGTTAGAGCTCTGTATAAATATAGGATGAAAGCATAGAT
TTGGATGCTGAAAGCGATCAAGAAAGTGATGATGATTCACATCTCACTCCAGAATAAAAA
TAACTAAAAGATAGATGGCTTCAAATATTCCAAAAAATATCTAAAAGTGTAAGAATTTAT
TTTTTATATTTACTATCTTAGTAAGTATAAAGTAAAGTTAAGACACATCATTATTTTTTA
AAACATTAAATACAAAGAGAATAAAGACGGATGAAGCTTTTGATTTTGATGTAGAATAGG
AACTTTAATTAGTTTTGTATGAGTGGAAAGACTCAGGATGTATATTAGAGTGTATTTCCA
AGCTCTATTCTATGAAAGTTGATAGACTATCAAAAGAGGCTTATCATTTATTAGCATGTA
TAGCAAGAGGATAAATAGGTGGAGACAAGAGTAAAGAAATGGAAAATGAAGAATAAGAGG
ATGAAAGCAAGAATGAAGGAAATAAATAAGACAGAAACGATTAAAGTATTCTTTAAAAAA
TCATTATTTTATATTTTAATCATTCAATTAATTAATAATTAGAAAAAAAGATAGTTTCAT
TTGAAGAAAAATAAATCTAACAAGGATCTTTTGAAAATTTTGATCCGTTTATTGCTGGTT
AAAAGCAGATAGAAAAGCCAGAAAAATTAATTGTTGATAAGTATGATATTCTTTTTGATC
TAGATCCTCTATTTAGGAAGAAAAGCTAGTATTTTGACGATACTAGCTCGGAAGGTCTTC
TTCTTAATGTACTGGAAGTAGATAAAGAGCTTTGTATAAATTTGTCTGAATTAGATGAGG
CATTGGGCAAATAGTAAAAATTAGTTTAAAGAGATTAAAAAAAATAGACTAAGTCAAATT
ATATGAAATTATTCACTTAAGAAGAATTTAAAAATAAATTCTCAGCTCCTGTTGAAGATT
AGATTATCGATTTATTTCCAGAATTAATTGATTTTAAGATGTCAGTGATTGACGAAGTTT
CTTAATAATTGCTATTTGATAATATTTAAAGTTTAAACTCTGAGAATGATATTAAGATTC
TAACTCAAAATAATAAAAAAATGGAAATCATGGATGAAAATTCTGCTTCTATAGTCAATT
AAGTGCTTTAAAATGAGAATGATAAAATTTTATTAAACGAAATAAACCTAGCATATTAAA
TGAATGCTTTTACCTCATAAAATTTTATGTACAGAAACCTGAGTGACGATTCATTGTTTC
AAAATGCATCTCAGTCTTCATAAAACAAAGAAGATTTTATTTTATCATAAATGTCTTAAA
GTTACACGCCTGATAACAGTATTTTTAAGAACACAAAGCAGATAAGATTCGATTTGAATG
ACGAATACTAAGGTTTTGATTCTTCAAATGACTATGCAAATTATCATGTATGTATAAATT
TCAGTTAAAACTTCTTCAATAAAATAGAAAATTGTAAAATATATTATAGGATGAAAATCC
ATCAACTTAAGAAACAAAGCAAATTGATAATTCTTTACTTCATAATTCTTTAAACAAAGT
AGGAGGAGGAGATAAAACAATATTCTCTAATTTTCTCATGTAAATTTTTAATTTATGTAA
TGTTTCTCAATAAAAATTTATTAAAAAGGAATTTAAATTGGGGAGACCCTAAGCAATGGG
ATATACAAAAGCTGAGTGCTAATAAAAGGAAAAAAATACGTTCAAAAAAATTGTAAGATG
ATCTATTACTTGGAGAGATAAAGGAAGATATGGAAGCTGAAGAATAAAATGAAAACATAG
CCATGAATAACCAGTATGAAAGATTAACGAAGCCACAAAAATATATTGATTTTAGCCTAA
ATAATGGAGTAATTTGTCAAAACATTAAAGATTAATTATAATTTATTTTCTAAACCAAAA
AGAAAGAAGAAAGCTATAAAGAAGTAATAGGCAAGAAATTTTAGAGATATAAGAGTAATT
TAGGATTAAAATATGTAAAAATAAAGTAGAAAAGTACTATTCAAAAAGATTATAAAATTA
CCAGTGAGCAGTACTAATTTTAATTATATTATGATAATATTTAAATATTTATTTTTTAAA
AGAGTATTCTAAATAGGTTTAAAATACATAGAAAATACAAAATAAAGTAGAATAAAGGAA
TTTACTAGTGAATATGACAGTTAATTTGATATATTTTAGTAGAGCTAATAGAATTAAAAT
ACAAGCTAAAATGCTATTAATTAAAATGATGAATATTAAAATGAGTACGAAGCTATTGGC
TTTGATGATTTATATGATGAAATGGATGATAGATTTTACAATCCTTAGAAGTATAATAAT
TAAAGAGATAATAGATTTTTTAACACACAAAGAGAAGGCTAAAGTCAATTTGATATTTAA
ATGAATAACTCACCATACGGAAGATATCAATACCCTTTCTCTGCTAATAATAATTCACAA
AGTCTCTACACTCAAAATAAAACCCAAAACTTTTTTTCATAAACTATAAAAAGAAAGCCT
GTGAGAATTAGAGATTTAAAAGAAACAGTATGGTAGACTATGACTTAATAGAAGAGCAAA
GAAAATAACAGCTAATTAACCTAATTAAGTTAAATTGTATAAGAAAATTAAAATAAAAGA
GGAAAAAGAAAAAATAAAGCCAAGCTATCTGAAAATGAAGAATAGGAGTAAATTGAAAGT
GCGATTACTCAAATTAATAGTGAAGATGTTTCTCTCAAGTTTAGTGATTTAATGCATTAA
TTACCAAATTCTCTTGGATAAGATAATTAAGCTTAGGGAGTTTCAGTCTAGAATTGCTTT
ATTAGCATACTGCATTTGGCAAACGAAAAACATCTTAGACTTGTTGATCCAAGTCACACT
GAGTTAGAATTTTTTATTTTCTTGGATTAAACATTACAAGAAAATGAAAACTCATAAAAC
CTTAGACGAAGCAAAATTTAAGAATCTTGA