Identifiers and Description

Gene Model Identifier

TTHERM_00919690

Standard Name

CPG1 (homolog of CAP-G or YCG1 condensin gene)

Aliases

PreTt07065 | 163.m00067 | 3754.m00271

Description

AT hook motif protein; AT hook motif family protein- condensin subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00919690

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19204.19.997093137033517e-262AT hook domain-containing prot
ein family protein (1712 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29237819: Howard-Till R, Loidl J (2018) Condensins promote chromosome individualization and segregation during mitosis, meiosis, and amitosis in Tetrahymena thermophila. Molecular biology of the cell 29(4):466-478

Sequences

>TTHERM_00919690(coding)
ATGGAAACAATAGCTGAAGTTTTCAATGAAGTTTAGGAGTCTACCTCAGTCTCTTAAAAG
CAAGTATATGCACTTCTTGAGTAGTATGAAACAAATAAAGCAGTATTTCTTAAAGCAACA
GAGCAATGCTATCTTAAAATTATCAAGAGCTTGCTTAAGGCACCAAGAAAATTAATTGAG
AAATATGAAAAATTGACTGAAAAATTATTTGAAACAGGATATCGTTAGTACGCTCTCAAA
GAAGATTAGTCATCAAAAAAATAAAAGTTAACAAAAAGGGATATCTTTTAACTTTTTTAA
CATTTCTTGGCATTTTTTGCTGGAGCTCTTGACTCCACTTAACTCTAAATAAGAATCTTC
TCTTCTCGTATAATTTTCTAACTCTTAAAGATATTACCTTCAGACACTCTTGTAGATATT
ATTGAAGTAAAAGTTGCTAAGTAATTAATATTAGGTACTCTTTCTTTGATGAAAGAGAAG
AAGGGTAACTTAAAGCACATAGGTATTAAGATTACGTCTTATTTGCAAAAATTAATGGAT
AGAGATGATCTTACAGAAACATAAGAAGCAAAAATTCTTAGAAGCGAAATGATGAAGAGT
ATGTGCATGGACGACTAAGACTAGATTAGAAAATTGGCATTAATCAACTTGGAAATGAAT
GAAAGCACCTTCCCCCATTTAATTAAGAGAATCAGAGATAAAAATCCTGAAATTAGAGCT
ACAGTCTTCAAGAAACTTATTAAAGAATAAATACCTCTTGCTAACTTAAATTTATCTGAT
ATTTATAAACTTATTTATGATGGTTTAGGATCTAGAGAATCATCTGTCCGTGAAGCATGT
ATAAGATATCTTTAGCTCAACTATAATTTGTTTAAGGAAGATGAAGAAAATCCTTAAAAA
AATTAAATTGAAGAAGAAATGGAATTAGAAGAGAACAAAGAAAAAGATGGAGAAAAAGAA
GAAAGCTCTGAAGATAATGAAATTGATGAAGAAAAAACTAAAAAAAAGCAAAGTAAATCT
GCAATTAAGAGATTTTTCACACCAAATAAAGAGACTGCCATGAAAGATTTGAAAATTAAA
ATTTTAAACTTTTTAAAAACCTTTGAAATTGAAAAGAGTCTTTACTACCCTGAATTATAC
GAGAGTTTAGAATTATTAGTAAAGGAAACTATCAAATAAATATTAGATGCTGATAGCTTC
TCAGCATACTTAAAGGATTGCTTTTTAAATCAACTTAGTCTTAAAAAGAAGAAAAAGCAC
ACTTAAATTTCAATCGAAGGAGAAGAGCTATTCCTAATTAGAGTCCTCTGTTAAATGGTT
TAAAATCAAGATGATAGAAAGGAACTCAGTCCTGAATTAGTAGCTGTAGTGGAAGATTGC
TTCCCAAACGGTGTTGATTTCTCTTAAGTGATTGACTACTATTCATTCACTTAGCCTAAT
TTATTTTCCCTCTATTAGGTTCTCCTTTTGGCAGAACTTCTCATTAATTGTGATGAATCA
GGAAGAAATAAAATTGAAGAAACTCTAAAAAATTTAGTTATTAACATGAGTAATACCAAT
TTAATATCCGAAATCCCAACTGATCCTTCTAATGAATACAATGATATTTTCTATTACCTT
GAACCAGATACTGTTATGAATAATATTTTTTCTCAATCATATTTCTTCTCTCCTATCATT
ACATGCTCGTATGAATTACTTCCAATTATAGTTCGTATTTTAAAGAAGATTGTGAGTGAT
GGTAGAGTGAATGTTCAACTTATCTAGCTTATTTCTGAAGTTCATGAGCCTCTAGCTAAA
GACACAGATAATGACTCACATTTTGATTTACCTTCAGAATTGGAAAGAATAAGAAATAGT
ATTAATGAAGAGAAAAAGAAACTCGATAATATTGAAAAAGAATTGTCGAATCTCAAAAAA
AATAAGACAAAATAAAACGAAATTTATCAATTAGAGAAGGAAAAAGATGAAAAATAAGCA
CATCTTAAAATTTGGGAAGAAAAGGAAGATGCTATTTAGTCAAAAATTTTTGATATTTCT
ATGAGAGAGCTTGTATTAGTTTAATCTCTACTCACTTATTGCAAAGTTGATCCTAAAGAT
CCTGCTATTTCAAATTTATTGTAGCAAATCATTTTACCTGGATTACATTCTTCTGATAGA
AGTTTAAACTTCAATTCCTTGAAATCACTTGCTCTCTATGTTTTGATTGATAAAAAGAAT
TGCATTGATTTCTTCTCTGTATTCAGCGATATTTTGGACAAGAGTGAAAACTGCTAGAAT
TGTACTCCACAAGAAATCATTTCATTGAGAAGCATAGTAGATTTCCTACTTCTATATGAT
CTCACTTAAAAGCAATCCCAAGATGACGAAGATATTGACATTCCTCAAACATAAGATTTA
ATACTTAAGTATGCTTATTAAGCTGATATTCTTCTTAGAACTATTTCAATTGAAGGGTTA
AGCAAATTGCTATTTAACGGAAAACTTCAAGACCCACACACTACTATTTGCTTACTTTTG
GTTATTTGGTTTGATACTAAAATCTGCACAAAATAAGGCTTTAAGGCTATTCAGATACTT
TCAACTTTATTTAAGACTTTCACTGCCTCGAACTATTACAATCTTCAAATATTTGAAAAA
GCTTTGGAATTATTCTCGTAGTTGATGGTTACACTTGAGAAGAAAGGATTAGTTTTTAAT
GATGAATATGTTATTTTTGATCATAGCAATGAAAAGTTTATTTCAAAGGCTCTTAGAGTT
GGAATTAACTTAATGTCCTATGAATATCATAATAACACTGAAGTGCTTAAAAACGTTTCT
TCTAATGAATTTCTTCCATAAGAAAGATTCTTCCTTTTCTTGGCATACAAATGCTCAAAA
GAAAGACGCTTCCAATCTCTTTTTGAAAAAATTACTTAGTACTTTGACTTTTACAATAAG
TGCACTACTGAGTAACTATAAATAATTCTTCACTTCTTAAAAGAAGCTATCGAAAATTGC
CCAGTTAGTAAACAGTTCAATTAATTGGAAAAAGTAATTAAAGACAAAATAAAGATTCAA
GATAAAAATGAAAGATAAGAAGAAGATGAAGAAAAAGAAGAATTAAATAAAGTTTTAGGT
AAAGAAAAGAGTGATAAAGAAGAAGCAAATGATGCAGAAAATGGTGAAAATGGCTTAAAG
AATGATGAAGATTAAAAGCTTTATACTTTAAATGCAAAACAATTAAAGATTTGTGATAAA
ATTATTGAACTATTTGAAGGTAACCAACAAGATATTGAAGTTATTGTCAAAAATCTCTTT
TCAAATGGAACGTTGATTAATGACTCTGCTGAGCAAAAGAAGAAAAGAGCTATGATGTAT
GATGAAGAAGATGAAGAAAGAGCAAATAATGAAGAAGATGATGATAATGAAAAAGAAGAA
AAGCCTAAACGTGGTAGACCTGCTAAAAGAAAATCTATCCACCCTAACTCAGACGATGAG
GAAGAAGGAGAAGATGATGATGAATAGGAAGAAGGTGCCTAAGAAGAAACAAAAAGAAGA
GGCAGACCTAAAAAAGATATCTCTGAAGCTTCTCATGCTCCATCATAGAGAGGTAGAAAG
AAAAAAGCTATCTATATTGATTAGGAAGAAGAAGAAGATAATGAAGAGGAAGAAGAATAA
GAAAATAAAGATTCTAAGAAAAACTCTGCAACTAGGAAAGCAAAGAATGCTAAAGAATTA
GAAGATATACTCAATTAAGAGACAGAAGAAGATGAAGATGATGAAGATAGAGAAGAAGTA
ATAAATAAAAGAACATCATCTAGAAGAGCTTAAAAAACAGTTTTACCAGAATCTAATGTT
GCTCAAAAGACTAGCAAAAGAGGAAGAAAGAAAAAAGATGTGTAAGATGAAGTTATTGAA
TAAGATGAAGAAGACGATGAATAAGAAGAAGAAGACATGTCAGCAGAATAAGACATTGAA
GAAGAAGATAAAAAGAATAAAAAATAAGTTGGAAGAAGAGGTAGAAAACCAGCTTCTACT
AAATCTATGGGTTCATCAAGTGAAAAAGAGAGTCCAAAAACTAACAGGAGAGGTAGAAGA
TCAGCATCAAAAGAGAATAAAATATCTGAAGAAAGTGATGAGGAACATAAAGAAACAGAC
AACGAAGATTAAGAAGAGGAATTGTCTTAAAAGAAAACAAGAGGCAGGGGCCGTCCTAAA
AAATCAAATGAAAAGACTTAATCATAGGAAGAAGAAGAAGGATAGGATAATTCATAATCT
GATGAATAAGAAGAAGAGGTGGAGGAAGAAGAAGCCCCTAGAAAAACAAGAGGAAGCTCA
AAAAAAAGTACACCAGCTTAAAAAAAATCAAAAACAAGATCTTCTTAGAAATCCGTTGAT
AATGAAGAGAGTGGTGAAGATGAGGAGCAAGAGGAGTAAAAACCTTAAAAGAAAGGAAGA
GGAAGACCTAAAGCTTAACCTAAAGAACCTGAATCAGAATAAGATGAGCAAAACGAAAGT
GAGCAAGAATAAGAAAATGAAAGTGAATAAGAGGAAGAAGAGGACGATAAGCAGACAAAA
AGAAGGGGAAGAAAACCAAAAAATGTTACTCAAGCAGTGAAAAGAACAACTAGACACAAT
AGTGCTAATAAAAATTCTGATAAAGAAGAGTCTGAAGGAGAAGAAGAAAATGAAGAAGAA
GAGTAAGAGGAAGATGAAGAAGAGTAAACTAGGGTTACTCGTAAGAGGGGTAGAAAACAA
GCTGATACAAAGAAGCCTACCAAGAATGAATCTGTAAGAAGCACAAGAAGAGGAGGTTCT
AGAAATAAAATGGAGGAAGAACATGAAGATGAGGAAGAGAACGAGTCTTCTGAACAAGAG
CATGAAGAGTAAGAAGAAGAGGAGGAAGAGTAAGAGTAGACTAAGACTAGAGGAAGACCT
AAAAAATCACCAGCAAACAAAAGTCAAGCAAAAGAAACTAGGGGAAGAGGTAGAAAAAAA
AATGAAAAATAATAGAGTGACTCATAAAGTGAAGATGAAGGAGAAGAGGAAGAAGATGAA
GAAGATCAATAAGCAAACTAAAGAACAACTAGAAGATAAAAATAATAAATAGAAACCTCG
AAAAAACCAGTGAGCTCCTCCTAAAGACTTAGAAGAAGAAAATGA


>TTHERM_00919690(protein)
METIAEVFNEVQESTSVSQKQVYALLEQYETNKAVFLKATEQCYLKIIKSLLKAPRKLIE
KYEKLTEKLFETGYRQYALKEDQSSKKQKLTKRDIFQLFQHFLAFFAGALDSTQLQIRIF
SSRIIFQLLKILPSDTLVDIIEVKVAKQLILGTLSLMKEKKGNLKHIGIKITSYLQKLMD
RDDLTETQEAKILRSEMMKSMCMDDQDQIRKLALINLEMNESTFPHLIKRIRDKNPEIRA
TVFKKLIKEQIPLANLNLSDIYKLIYDGLGSRESSVREACIRYLQLNYNLFKEDEENPQK
NQIEEEMELEENKEKDGEKEESSEDNEIDEEKTKKKQSKSAIKRFFTPNKETAMKDLKIK
ILNFLKTFEIEKSLYYPELYESLELLVKETIKQILDADSFSAYLKDCFLNQLSLKKKKKH
TQISIEGEELFLIRVLCQMVQNQDDRKELSPELVAVVEDCFPNGVDFSQVIDYYSFTQPN
LFSLYQVLLLAELLINCDESGRNKIEETLKNLVINMSNTNLISEIPTDPSNEYNDIFYYL
EPDTVMNNIFSQSYFFSPIITCSYELLPIIVRILKKIVSDGRVNVQLIQLISEVHEPLAK
DTDNDSHFDLPSELERIRNSINEEKKKLDNIEKELSNLKKNKTKQNEIYQLEKEKDEKQA
HLKIWEEKEDAIQSKIFDISMRELVLVQSLLTYCKVDPKDPAISNLLQQIILPGLHSSDR
SLNFNSLKSLALYVLIDKKNCIDFFSVFSDILDKSENCQNCTPQEIISLRSIVDFLLLYD
LTQKQSQDDEDIDIPQTQDLILKYAYQADILLRTISIEGLSKLLFNGKLQDPHTTICLLL
VIWFDTKICTKQGFKAIQILSTLFKTFTASNYYNLQIFEKALELFSQLMVTLEKKGLVFN
DEYVIFDHSNEKFISKALRVGINLMSYEYHNNTEVLKNVSSNEFLPQERFFLFLAYKCSK
ERRFQSLFEKITQYFDFYNKCTTEQLQIILHFLKEAIENCPVSKQFNQLEKVIKDKIKIQ
DKNERQEEDEEKEELNKVLGKEKSDKEEANDAENGENGLKNDEDQKLYTLNAKQLKICDK
IIELFEGNQQDIEVIVKNLFSNGTLINDSAEQKKKRAMMYDEEDEERANNEEDDDNEKEE
KPKRGRPAKRKSIHPNSDDEEEGEDDDEQEEGAQEETKRRGRPKKDISEASHAPSQRGRK
KKAIYIDQEEEEDNEEEEEQENKDSKKNSATRKAKNAKELEDILNQETEEDEDDEDREEV
INKRTSSRRAQKTVLPESNVAQKTSKRGRKKKDVQDEVIEQDEEDDEQEEEDMSAEQDIE
EEDKKNKKQVGRRGRKPASTKSMGSSSEKESPKTNRRGRRSASKENKISEESDEEHKETD
NEDQEEELSQKKTRGRGRPKKSNEKTQSQEEEEGQDNSQSDEQEEEVEEEEAPRKTRGSS
KKSTPAQKKSKTRSSQKSVDNEESGEDEEQEEQKPQKKGRGRPKAQPKEPESEQDEQNES
EQEQENESEQEEEEDDKQTKRRGRKPKNVTQAVKRTTRHNSANKNSDKEESEGEEENEEE
EQEEDEEEQTRVTRKRGRKQADTKKPTKNESVRSTRRGGSRNKMEEEHEDEEENESSEQE
HEEQEEEEEEQEQTKTRGRPKKSPANKSQAKETRGRGRKKNEKQQSDSQSEDEGEEEEDE
EDQQANQRTTRRQKQQIETSKKPVSSSQRLRRRK


>TTHERM_00919690(gene)
ATGGAAACAATAGCTGAAGTTTTCAATGAAGTTTAGGAGTCTACCTCAGTCTCTTAAAAG
CAAGTATATGCACTTCTTGAGTAGTATGAAACAAATAAAGCAGTATTTCTTAAAGCAACA
GAGCAATGCTATCTTAAAATTATCAAGAGCTTGCTTAAGGCACCAAGAAAATTAATTGAG
AAATATGAAAAATTGACTGAAAAATTATTTGAAACAGGATATCGTTAGTACGCTCTCAAA
GAAGATTAGTCATCAAAAAAATAAAAGTTAACAAAAAGGGATATCTTTTAACTTTTTTAA
CATTTCTTGGCATTTTTTGCTGGAGCTCTTGACTCCACTTAACTCTAAATAAGAATCTTC
TCTTCTCGTATAATTTTCTAACTCTTAAAGATATTACCTTCAGACACTCTTGTAGATATT
ATTGAAGTAAAAGTTGCTAAGTAATTAATATTAGGTACTCTTTCTTTGATGAAAGAGAAG
AAGGGTAACTTAAAGCACATAGGTATTAAGATTACGTCTTATTTGCAAAAATTAATGGAT
AGAGATGATCTTACAGAAACATAAGAAGCAAAAATTCTTAGAGTAATTTAAATAATTTGT
GATTTTTAAATTCAAAATGTGATATGAGACAACATTTATATTATAAATATAGATTCAGAA
TTTTAGTTAGATATTTTCTATAATATTAAAATTTAGTTAGTCTTTTAAAATTTGATGCTG
ATTTTTGGATCAATTTTTTGTTAGTTTGCAAAAAATTAAAAATTTCGCAAACAAAATCAA
AAAAGATATAAAAATTTATTGTCTTAGAATTAAGAGACAGTTTTTATTTAATTATTTATT
TAAGTTTTTTTAACTTTCATTAATTTAAAATATATTTTTTTTATTCACTTAGAGCGAAAT
GATGAAGAGTATGTGCATGGACGACTAAGACTAGATTAGAAAATTGGCATTAATCAACTT
GGAAATGAATGAAAGCACCTTCCCCCATTTAATTAAGAGAATCAGAGATAAAAATCCTGA
AATTAGAGCTACAGTCTTCAAGAAACTTATTAAAGAATAAATACCTCTTGCTAACTTAAA
TTTATCTGATATTTATAAACTTATTTATGATGGTTTAGGATCTAGAGAATCATCTGTCCG
TGAAGCATGTATAAGATATCTTTAGCTCAACTATAATTTGTTTAAGGAAGATGAAGAAAA
TCCTTAAAAAAATTAAGTAAATTAAAGTAAAAAATTTATATTTTAAATAAAAAATTTCAT
TAAATATATAGATTGAAGAAGAAATGGAATTAGAAGAGAACAAAGAAAAAGATGGAGAAA
AAGAAGAAAGCTCTGAAGATAATGAAATTGATGAAGAAAAAACTAAAAAAAAGCAAAGTA
AATCTGCAATTAAGAGATTTTTCACACCAAATAAAGAGACTGCCATGAAAGATTTGAAAA
TTAAAATTTTAAACTTTTTAAAAACCTTTGAAATTGAAAAGAGTCTTTACTACCCTGAAT
TATACGAGAGTTTAGAATTATTAGTAAAGGAAACTATCAAATAAATATTAGATGCTGATA
GCTTCTCAGCATACTTAAAGGATTGCTTTTTAAATCAACTTAGTCTTAAAAAGAAGAAAA
AGCACACTTAAATTTCAATCGAAGGAGAAGAGCTATTCCTAATTAGAGTCCTCTGTTAAA
TGGTTTAAAATCAAGATGATAGAAAGGAACTCAGTCCTGAATTAGTAGCTGTAGTGGAAG
ATTGCTTCCCAAACGGTGTTGATTTCTCTTAAGTGATTGACTACTATTCATTCACTTAGC
CTAATTTATTTTCCCTCTATTAGGTTCTCCTTTTGGCAGAACTTCTCATTAATTGTGATG
AATCAGGAAGAAATAAAATTGAAGAAACTCTAAAAAATTTAGTTATTAACATGAGTAATA
CCAATTTAATATCCGAAATCCCAACTGATCCTTCTAATGAATACAATGATATTTTCTATT
ACCTTGAACCAGATACTGTTATGAATAATATTTTTTCTCAATCATATTTCTTCTCTCCTA
TCATTACATGCTCGTATGAATTACTTCCAATTATAGTTCGTATTTTAAAGAAGGTAAAAA
TTTTTTAGTAAAAAAATATTTGTCAAATTTATGTAATTTTTATTTTTTAAAAATAAAGAT
TGTGAGTGATGGTAGAGTGAATGTTCAACTTATCTAGCTTATTTCTGAAGTTCATGAGCC
TCTAGCTAAAGACACAGATAATGACTCACATTTTGATTTACCTTCAGAATTGGAAAGAAT
AAGAAATAGTATTAATGAAGAGAAAAAGAAACTCGATAATATTGAAAAAGAATTGTCGAA
TCTCAAAAAAAATAAGACAAAATAAAACGAAATTTATCAATTAGAGAAGGAAAAAGATGA
AAAATAAGCACATCTTAAAATTTGGGAAGAAAAGGAAGATGCTATTTAGTCAAAAATTTT
TGATATTTCTATGAGAGAGCTTGTATTAGTTTAATCTCTACTCACTTATTGCAAAGTTGA
TCCTAAAGATCCTGCTATTTCAAATTTATTGTAGCAAATCATTTTACCTGGATTACATTC
TTCTGATAGAAGTTTAAACTTCAATTCCTTGAAATCACTTGCTCTCTATGTTTTGATTGA
TAAAAAGAATTGCATTGATTTCTTCTCTGTATTCAGCGATATTTTGGACAAGAGTGAAAA
CTGCTAGAATTGTACTCCACAAGAAATCATTTCATTGAGAAGCATAGTAGATTTCCTACT
TCTATATGATCTCACTTAAAAGCAATCCCAAGATGACGAAGATATTGACATTCCTCAAAC
ATAAGATTTAATACTTAAGTATGCTTATTAAGGTATTAAATATATCTGATCGACATTATT
CCTTTATCTAATTAAACTTTTTTATTAAAAGCTGATATTCTTCTTAGAACTATTTCAATT
GAAGGGTTAAGCAAATTGCTATTTAACGGAAAACTTCAAGACCCACACACTGTAAAAAAA
ATTTTTTTTAATGCATTTTACTTATTTAAAAAATATTGATTTTTAATTCTAGACTATTTG
CTTACTTTTGGTTATTTGGTTTGATACTAAAATCTGCACAAAATAAGGCTTTAAGGCTAT
TCAGATACTTTCAACTTTATTTAAGACTTTCACTGCCTCGAACTATTACAATCTTCAAAT
ATTTGAAAAAGCTTTGGAATTATTCTCGTAGTTGATGGTTACACTTGAGAAGAAAGGATT
AGTTTTTAATGATGAATATGTTATTTTTGATCATAGCAATGAAAAGTTTATTTCAAAGGC
TCTTAGAGTTGGAATTAACTTAATGTCCTATGAATATCATAATAACACTGAAGTGCTTAA
AAACGTTTCTTCTAATGAATTTCTTCCATAAGAAAGATTCTTCCTTTTCTTGGCATACAA
ATGCTCAAAAGAAAGACGCTTCCAATCTCTTTTTGAAAAAATTACTTAGTACTTTGACTT
TTACAATAAGTGCACTACTGAGTAACTATAAATAATTCTTCACTTCTTAAAAGAAGCTAT
CGAAAATTGCCCAGTTAGTAAACAGTTCAATTAATTGGAAAAAGTAATTAAAGACAAAAT
AAAGATTCAAGATAAAAATGAAAGATAAGAAGAAGATGAAGAAAAAGAAGAATTAAATAA
AGTTTTAGGTAAAGAAAAGAGTGATAAAGAAGAAGCAAATGATGCAGAAAATGGTGAAAA
TGGCTTAAAGAATGATGAAGATTAAAAGCTTTATACTTTAAATGCAAAACAATTAAAGAT
TTGTGATAAAATTATTGAACTATTTGAAGGTAACCAACAAGATATTGAAGTTATTGTCAA
AAATCTCTTTTCAAATGGAACGTTGATTAATGACTCTGCTGAGCAAAAGAAGAAAAGAGC
TATGATGTATGATGAAGAAGATGAAGAAAGAGCAAATAATGAAGAAGATGATGATAATGA
AAAAGAAGAAAAGCCTAAACGTGGTAGACCTGCTAAAAGAAAATCTATCCACCCTAACTC
AGACGATGAGGAAGAAGGAGAAGATGATGATGAATAGGAAGAAGGTGCCTAAGAAGAAAC
AAAAAGAAGAGGCAGACCTAAAAAAGATATCTCTGAAGCTTCTCATGCTCCATCATAGAG
AGGTAGAAAGAAAAAAGCTATCTATATTGATTAGGAAGAAGAAGAAGATAATGAAGAGGA
AGAAGAATAAGAAAATAAAGATTCTAAGAAAAACTCTGCAACTAGGAAAGCAAAGAATGC
TAAAGAATTAGAAGATATACTCAATTAAGAGACAGAAGAAGATGAAGATGATGAAGATAG
AGAAGAAGTAATAAATAAAAGAACATCATCTAGAAGAGCTTAAAAAACAGTTTTACCAGA
ATCTAATGTTGCTCAAAAGACTAGCAAAAGAGGAAGAAAGAAAAAAGATGTGTAAGATGA
AGTTATTGAATAAGATGAAGAAGACGATGAATAAGAAGAAGAAGACATGTCAGCAGAATA
AGACATTGAAGAAGAAGATAAAAAGAATAAAAAATAAGTTGGAAGAAGAGGTAGAAAACC
AGCTTCTACTAAATCTATGGGTTCATCAAGTGAAAAAGAGAGTCCAAAAACTAACAGGAG
AGGTAGAAGATCAGCATCAAAAGAGAATAAAATATCTGAAGAAAGTGATGAGGAACATAA
AGAAACAGACAACGAAGATTAAGAAGAGGAATTGTCTTAAAAGAAAACAAGAGGCAGGGG
CCGTCCTAAAAAATCAAATGAAAAGACTTAATCATAGGAAGAAGAAGAAGGATAGGATAA
TTCATAATCTGATGAATAAGAAGAAGAGGTGGAGGAAGAAGAAGCCCCTAGAAAAACAAG
AGGAAGCTCAAAAAAAAGTACACCAGCTTAAAAAAAATCAAAAACAAGATCTTCTTAGAA
ATCCGTTGATAATGAAGAGAGTGGTGAAGATGAGGAGCAAGAGGAGTAAAAACCTTAAAA
GAAAGGAAGAGGAAGACCTAAAGCTTAACCTAAAGAACCTGAATCAGAATAAGATGAGCA
AAACGAAAGTGAGCAAGAATAAGAAAATGAAAGTGAATAAGAGGAAGAAGAGGACGATAA
GCAGACAAAAAGAAGGGGAAGAAAACCAAAAAATGTTACTCAAGCAGTGAAAAGAACAAC
TAGACACAATAGTGCTAATAAAAATTCTGATAAAGAAGAGTCTGAAGGAGAAGAAGAAAA
TGAAGAAGAAGAGTAAGAGGAAGATGAAGAAGAGTAAACTAGGGTTACTCGTAAGAGGGG
TAGAAAACAAGCTGATACAAAGAAGCCTACCAAGAATGAATCTGTAAGAAGCACAAGAAG
AGGAGGTTCTAGAAATAAAATGGAGGAAGAACATGAAGATGAGGAAGAGAACGAGTCTTC
TGAACAAGAGCATGAAGAGTAAGAAGAAGAGGAGGAAGAGTAAGAGTAGACTAAGACTAG
AGGAAGACCTAAAAAATCACCAGCAAACAAAAGTCAAGCAAAAGAAACTAGGGGAAGAGG
TAGAAAAAAAAATGAAAAATAATAGAGTGACTCATAAAGTGAAGATGAAGGAGAAGAGGA
AGAAGATGAAGAAGATCAATAAGCAAACTAAAGAACAACTAGAAGATAAAAATAATAAAT
AGAAACCTCGAAAAAACCAGTGAGCTCCTCCTAAAGACTTAGAAGAAGAAAATGA