Identifiers and Description

Gene Model Identifier

TTHERM_00392760

Standard Name

CPD2 (CAP-D2 homolog)

Aliases

PreTt23504 | 42.m00238 | 3813.m01460 | CPDT2

Description

Condensin subunit; homolog of CAP-D2 or S. cerevisiae YCS4

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00392760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11482.19.997093137033517e-262hypothetical protein (1495 aa)
OxytrichaContig17170.0.g396.996594825025754e-146non-SMC mitotic condensation c
omplex subunit 1
SGDYLR272C9.001992589090134e-64YCS4 Subunit of the condensin
complex; required for establis
hment and maintenance of chrom
osome condensation, chromosome
segregation, chromatin bindin
g of condensin, tRNA gene clus
tering at the nucleolus, and s
ilencing at the mating type lo
cus
DictyBaseDDB_G02939845.000412888119721e-59ncapD2 on chromosome: 6 positi
on 3563765 to 3568484
Stentor CoeruleusSteCoe_99697.095474162284704e-23
WormBaseWBGene000010870.000000000003998907168546896locus:dpy-28 Condensin compl
ex subunit 1 status:Confirme
d UniProt:Q9U2M1 protein_i
d:CAA16340.3

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29237819: Howard-Till R, Loidl J (2018) Condensins promote chromosome individualization and segregation during mitosis, meiosis, and amitosis in Tetrahymena thermophila. Molecular biology of the cell 29(4):466-478

Sequences

>TTHERM_00392760(coding)
ATGGTTGATTATTTCGTATTTCCTTATACTTACGAAGACATCTTGAAGTCTGCAGACGAG
AGATATTGCGTCAATGCGGAAGAATAGAGGAGAATAAAAAATATGGAAGATAAGAGAATG
AATAGAACCCTGAAAGAATTAGAATCTGCCTTTGTCGAGGACTATACTGAAATAAAGTAG
CACGAAAGATTCGATATACTCTACTTTCTGATCGATAATTTCGGCTCAAAAAATAGTGAA
TCTCCAAATTTAATCAAGTTTAGTCTATCCACAATTGAATAAACAGGAGAATTGCTTCTT
ACATATTTAAATTCGCATTTGAGAAGAGTAAAAGAGGATTGCTAGAATCAGAATATTGCT
CCTGAAGTACTTGCAGATGATAGACATTCTTTGAAAATGATTATATTTTTGACTACCTTC
TTCCTTAGAAACACATGCATAAGACGTATATCAACAATGAAGGAAGATAACAATGACGAA
GCTCATCAAAATAAGAAAGGCAAAAAGAATACAGGTGGAGAAGAAAATTATGATAATCTA
ATTGAAAAGCAAAGAATTTGCATAGATTTGCTATAGAAGACTCTTTAATTAGATCTCAAA
ACTCTTTACCAAAAGAAATCTATTGATGAGGAATTTTATAAATATTATTTGGCTACTGCT
TTAAGATTACTCGAAAGTAAGCCTTTCATTAGGGCAGAAAAGGCTCGTACCAATATATTT
GCTATTATTAGAACTGTCATGAGAGTATTTTCTGAGTATAACAAATAAGAATTGAAGCAA
GTTTAACTTAATTTCATTAATCTTATCTATGAAGACGAAAATTTAGTTCAGCCTATTGCA
GATTTTATAATTGATCTTTATAATGATAAAAATTTAATCTTTTCAAAGGAATTTACTTTC
GATTTGCTACAAATATTGGTCACTTTCTTGCAAGAAAAAACAAGCCCTTCTTCTGAAAAT
ACAGTATTTAAAAATGCTAGAGATTTCTTCTCTATTTTAAGTAACCACTTGCCTAAAATT
TTCATTAACAATTTATCATGCTTCTTGACATTATTTGATTCTGAATCCTATTTAATGCGT
AATACTGTCTGTGAAATTTTGGGAAATATTTTAAAAAATGTGCTTACTGCTTAAAACGAA
GAAGATGAGGAATTCATTTTAAATGAAGAATCAAAGATAAAGTAAAAAGAAAAACTTTTG
GATCGTTTAATTGACAGAGTTTATGATAAGCATGCTTACAGTCGTGCATAAGTCTTAACA
ATATTAGCCGATTTATGCGAGAACAATGCTATCCCACCTCAATTTTTACCATAAATATTA
AAAGCTGCTATTAGCAGAACTAGAGATGTTGGTGCTATTGTCAGAAGAAAAGCTCTCTAA
TTGATTAGCAGAGTAGTTAATTATTATGTTTATATCTACCAAACCAACAAAGATGGAAAG
TTTATCACAAAAGAATAAGTCATTAAAGAAATCAAAAAGCTTGATATGTAAAATTTATCA
TGTGCAGAATAGCTTGAAAAGATTGAAGAAAGACTCAGAGAAATCACTCAATCTGAAGAC
CCTGCTGAATTGCTTTTACAACAGGATGAAATTGAAAGCTTAACAACCAGACAAAAAAGT
ATAAAAGCTTAGATGGCTTAAATTGCTTAATTATAAAGCAGATATTAGGAATATTAAGAT
TTTTTGCATGCACTTGATATTCTTATCCCTATTTTAATTTAGCTTCTTGGTTCCAAGAGT
GTCTATGATGTTTTAGAAACTATTAGACTTTTGATGTACTTAAAGAAGTATAACATCACA
ACTAGCGAGCTTGGTATTAAGAAAATGATAGTTTTAATTTGGTCAAAGGAAAAAGCTGTC
AAAGAAGAAGTTATGCAAACATATTGGTCTATATACATGAATAATAAAGAACAAAAGCCT
TAGAGAATCGCTAAAAATTTGATCAATTTGATGATAGATACTAACATAACTGAAGCTTCT
AGCTTTGAAGAATTGCTCTTAAGCATGATGGACACACATAAGATATCTTAAGAAGAACTT
AAAAGCTAGAATCTTAAGGCCTATCCTATTCAAGATTAGGTTTTTGCTGAAGTTTGGGAA
ATATTCACTAAAAATTTTAGACGTTTATGTGAAGCTGATCCTAACCGTGAAAGAACTGAG
CAAGAAAGTTTAGAATATGAAAAAGAACTTATTTTACAAAAAAAAGAGATGAGAAGTGCT
ATTCAAATTCTTCGTATTATCAGTAGCAGATAAAAGAGCAATTGGAGCATGAAACTTGAA
AGCTTTAAGAACATCCTCAATTACTATAAGAAATTCGTCAATAAAGTTGACTGGGTTATT
GTCAAAGAAATTGCTTGCATTTCAGAATAGGTAAAATCAGAAGATAACAAGGCTATTATT
GAGTCTATTGCTCAAATTTTAACAGTTCTTCTAATCAGGGGTCACGGAACTGAAGATTCT
GAGTGGTTCTTGTCATGTGAACAGATCATCAGATTGACATTTTTAACATTTACAAACCCA
GAAACTATCATAAAATATTTAATTAAAAAAATGAGCCAATTTTTGTTTGAAAAGAAAATT
GCTAATGAAGGTGGTGCTGTTGATGAAGAAGAAGATGAACCTAATTAGAATAAAGATGAC
TTAGAAATGCAGCTTGAGAAAGATAACAAAAAGGATGATGGAGTTTAAAAGCCTCTTACA
AGCAAAGCCTATGAGCATAAGCTAGCTCAAGTCTTGTACGTTGCAGGTAATAGTGCATTA
AAATTCTTGATGCATTGTGATAGAATCGAAGAATATTTGAATAAACGTAGAATAGAAGCT
GAAAACAACAAATAGAAGGAAATGTAAAATGATGCTAATGACAATGAAGATAAAGACATA
GATAAGATCAATGGAGGTTTCGAGGCTGAATTTGAAGAACATCAAAGAACTTTGCATAGT
ATTTAGGATAAACTCATCATCGAGTCTCCAATTTATAGCTACTTCTGTAGTATCGCAACA
AAAATATGTTGGAATATGTTCAATTCACTAAGTTTAGCTCAAAGAAGCGAAGCAGATAAT
ATCAATAATAAATTAAGAAGAAATGTTATTTTGGACAGAGTTGCAATGCTATGTTTAATT
AAATTTATGTGTGTTTCCTCTTAAGTATGTAAGAAAAATCTTGATTTAATTTTCAATATG
TTGGAATCTTAAGCTGATGCAATCGTTAAAACAAATATCTTAATTGGTATTGGTGACCTC
TATCATAGATATCCTATCATACTTGAAAGATACTTACACTTTGTCTACAAGTCACTTTCT
GACAAAGATGTTAGAGTTAGAAAGACCTGCTTGATGGTTATAACTCACTTAGTGCTTAAC
GATATGCTTAAGGTCAAAGCTGAAATCTCCTCTATTGCAATTCTAATTGAAGACTCTGAT
TAGAGAATTCAAAATATGGTTAAGTTATTCTTCCATGAGTTGAATAAGAAAGATCCCAAG
GCTATTTACAATTTGTTGCCTGAATTGATTGGCAGATTATCTACTGAGAATATTAATGAG
TCTATCTTTAATAACTTTTGTGAAAATGTGTTACCACATATCGATAAGGATAAATAAGCA
GAGTCTCTTGTTGATAAACTTTGCTAACGTTTCACTTTAGTTAACACTGAAAAGGAATGG
ATTAATATCTCTCATGCTCTTAAAATGTTCTCGTACAATGAAAAGAGCTTAAAGAAACTA
TTGGAACACTTTGAATCTAAATATAGAGAGAAATTGAATATTCCCATTATTTTAGAAAAC
TTCAAGGCAATAATCTTAAAAACCAAAAAAATGCCTCGTTAATCATAGGAGTAAAAGCAA
TTAATTGATGAACTTGACAGCAAAATATCTAATTTCAAAAAAGAGACTTTTGATGATAAA
AAATACAAGAAAGAGAAGCCTAAACCCAAACAAGCAGCTGGAACTAAAGGAAACTAAGCT
AACAAAGGAGCTGTAGGAAATGCCTAAAAGAAAGGAAAATAAAATGTTTAAGTACCCAAT
CCATAATAATCAAAGAAAGGTTAATAGTAAATGATGGAAATTGAGTCTGATGAAGAAGAA
GAAGCTGTATTTTAACCTAATAGAAGATCTCAACAATAACAACAGCAACAGCTTCGTGGA
GGACCTGGTAAAATTTTAAAATCTAATTTGGAAGAAGTGAAAAATGTTAAGAATGCTTTA
TTAGCAGCCAACCATCCAAATAACTAAAGGAACACCAAATAAAGGGCTGAACCTGAAGAA
ATTGATATTGAAGATGATGATTTTGATGAAGAGGAGGAAGAAGAGTTTGTTGGACATAAC
AGAGGTTAATCTAGCAGAGCTTAATAAAGTAATTAAAGAGCATCATCAAGAAATGTACAG
AGAAAATCGTTGAAAGAAGATTCAGATGATGATGACTTTGATGAGGAGTTTTGA


>TTHERM_00392760(protein)
MVDYFVFPYTYEDILKSADERYCVNAEEQRRIKNMEDKRMNRTLKELESAFVEDYTEIKQ
HERFDILYFLIDNFGSKNSESPNLIKFSLSTIEQTGELLLTYLNSHLRRVKEDCQNQNIA
PEVLADDRHSLKMIIFLTTFFLRNTCIRRISTMKEDNNDEAHQNKKGKKNTGGEENYDNL
IEKQRICIDLLQKTLQLDLKTLYQKKSIDEEFYKYYLATALRLLESKPFIRAEKARTNIF
AIIRTVMRVFSEYNKQELKQVQLNFINLIYEDENLVQPIADFIIDLYNDKNLIFSKEFTF
DLLQILVTFLQEKTSPSSENTVFKNARDFFSILSNHLPKIFINNLSCFLTLFDSESYLMR
NTVCEILGNILKNVLTAQNEEDEEFILNEESKIKQKEKLLDRLIDRVYDKHAYSRAQVLT
ILADLCENNAIPPQFLPQILKAAISRTRDVGAIVRRKALQLISRVVNYYVYIYQTNKDGK
FITKEQVIKEIKKLDMQNLSCAEQLEKIEERLREITQSEDPAELLLQQDEIESLTTRQKS
IKAQMAQIAQLQSRYQEYQDFLHALDILIPILIQLLGSKSVYDVLETIRLLMYLKKYNIT
TSELGIKKMIVLIWSKEKAVKEEVMQTYWSIYMNNKEQKPQRIAKNLINLMIDTNITEAS
SFEELLLSMMDTHKISQEELKSQNLKAYPIQDQVFAEVWEIFTKNFRRLCEADPNRERTE
QESLEYEKELILQKKEMRSAIQILRIISSRQKSNWSMKLESFKNILNYYKKFVNKVDWVI
VKEIACISEQVKSEDNKAIIESIAQILTVLLIRGHGTEDSEWFLSCEQIIRLTFLTFTNP
ETIIKYLIKKMSQFLFEKKIANEGGAVDEEEDEPNQNKDDLEMQLEKDNKKDDGVQKPLT
SKAYEHKLAQVLYVAGNSALKFLMHCDRIEEYLNKRRIEAENNKQKEMQNDANDNEDKDI
DKINGGFEAEFEEHQRTLHSIQDKLIIESPIYSYFCSIATKICWNMFNSLSLAQRSEADN
INNKLRRNVILDRVAMLCLIKFMCVSSQVCKKNLDLIFNMLESQADAIVKTNILIGIGDL
YHRYPIILERYLHFVYKSLSDKDVRVRKTCLMVITHLVLNDMLKVKAEISSIAILIEDSD
QRIQNMVKLFFHELNKKDPKAIYNLLPELIGRLSTENINESIFNNFCENVLPHIDKDKQA
ESLVDKLCQRFTLVNTEKEWINISHALKMFSYNEKSLKKLLEHFESKYREKLNIPIILEN
FKAIILKTKKMPRQSQEQKQLIDELDSKISNFKKETFDDKKYKKEKPKPKQAAGTKGNQA
NKGAVGNAQKKGKQNVQVPNPQQSKKGQQQMMEIESDEEEEAVFQPNRRSQQQQQQQLRG
GPGKILKSNLEEVKNVKNALLAANHPNNQRNTKQRAEPEEIDIEDDDFDEEEEEEFVGHN
RGQSSRAQQSNQRASSRNVQRKSLKEDSDDDDFDEEF


>TTHERM_00392760(gene)
ATGGTTGATTATTTCGTATTTCCTTATACTTACGAAGACATCTTGAAGTCTGCAGACGAG
AGATATTGCGTCAATGCGGAAGAATAGAGGAGAATAAAAAATATGGAAGATAAGAGAATG
AATAGAACCCTGAAAGAATTAGAATCTGCCTTTGTCGAGGACTATACTGAAATAAAGTAG
CACGAAAGGTAAATTAATAATTGTTATCAAACAAACATCAGCAGTCATTTGCAAATATAA
ATTGAATAAAAATGAAAATTATTTTTAAGGATTAGCAAATATTAACCCTTATTAACGTAT
TTAAATTAGATTCGATATACTCTACTTTCTGATCGATAATTTCGGCTCAAAAAATAGTGA
ATCTCCAAATTTAATCAAGTTTAGTCTATCCACAATTGAATAAACAGGAGAATTGCTTCT
TACATATTTAAATTCGCATTTGAGAAGAGTAAAAGAGGATTGCTAGAATCAGAATATTGC
TCCTGAAGTACTTGCAGATGATAGACATTCTTTGAAAATGATTATATTTTTGACTACCTT
CTTCCTTAGAAACACATGCATAAGACGTATATCAACAATGAAGGAAGATAACAATGACGA
AGCTCATCAAAATAAGAAAGGTAAGCTTTAAAATGAATGAATCAATTAACTATCAAACAA
AATGGAAATATGGAATTTAAAATAAACTAATAATTAAATAAATCAAAATATTCTATTCAA
ATAAAAATTAATAAATCCCTCTAAATTGATGAAATTTGAAAATTTTATTTGAAATAACAT
ACATAAAATTTTTTTGTTATTAGAGCAAATTACCAAAAACATTTTAATCATTAATCACAA
CAAGTTTTTGAAAGTAAATTGCTGGACCAAATTAAAAACAAAAATTAAATTTAAACTATC
AACAAAATGCCTATGATTTTTTTCTGATAAAAATGTATTAAATCACTTATTAATATTTCA
AAGGCAAAAAGAATACAGGTGGAGAAGAAAATTATGATAATCTAATTGAAAAGCAAAGAA
TTTGCATAGATTTGCTATAGAAGACTCTTTAATTAGATCTCAAAACTCTTTACCAAAAGA
AATCTATTGATGAGGAATTTTATAAATATTATTTGGCTACTGCTTTAAGATTACTCGAAA
GTAAGCCTTTCATTAGGGCAGAAAAGGCTCGTACCAATATATTTGCTATTATTAGAACTG
TCATGAGAGTATTTTCTGAGTATAACAAATAAGAATTGAAGCAAGTTTAACTTAATTTCA
TTAATCTTATCTATGAAGACGAAAATTTAGTTCAGCCTATTGCAGATTTTATAATTGATC
TTTATAATGATAAAAATTTAATCTTTTCAAAGGAATTTACTTTCGATTTGCTACAAATAT
TGGTCACTTTCTTGCAAGAAAAAACAAGCCCTTCTTCTGAAAATACAGTAAATTTTTTAT
TTGAAAACGAAATAAGTGATTATTCATTCATTCTATAATAAAAATAATAAGGTATTTAAA
AATGCTAGAGATTTCTTCTCTATTTTAAGTAACCACTTGCCTAAAATTTTCATTAACAAT
TTATCATGCTTCTTGACATTATTTGATTCTGAATCCTATTTAATGCGTAATACTGTCTGT
GAAATTTTGGGAAATATTTTAAAAAATGTGCTTACTGCTTAAAACGAAGAAGATGAGGAA
TTCATTTTAAATGAAGAATCAAAGATAAAGTAAAAAGAAAAACTTTTGGATCGTTTAATT
GACAGAGTTTATGATAAGCATGCTTACAGTCGTGCATAAGTCTTAACAATATTAGCCGAT
TTATGCGAGAACAATGCTATCCCACCTCAATTTTTACCATAAATATTAAAAGCTGCTATT
AGCAGAACTAGAGATGTTGGTAAGTAAATTAAAATAAATTATAAATAAATAATATTTAAT
AAATATAAAGGTGCTATTGTCAGAAGAAAAGCTCTCTAATTGATTAGCAGAGTAGTTAAT
TATTATGTTTATATCTACCAAACCAACAAAGATGGAAAGTTTATCACAAAAGAATAAGTC
ATTAAAGAAATCAAAAAGCTTGATATGTAAAATTTATCATGTGCAGAATAGCTTGAAAAG
ATTGAAGAAAGACTCAGAGAAATCACTCAATCTGAAGACCCGTAATAATTAAAAATACTT
CATTTAAAACTAAAATTTTACTTTAAAGTTTAAGCATTATATTTTCTTTTAAATATTAAA
CACTATTTTTTCCTTTAAAGATTTAATATTGTTTTTTCCTTTAAAGCTTAAAAATTGTTT
TTTGCTTTAAATTTTTGGAAAATGATTTTTATTAAATTTGAGCGTTTGAGAAAATCTTTC
GAAAATAAAAGAAATCAATATTAAAACATAGAAATTTAATAAATCAATGGATATAAATTT
CTCTCAAATTGATAATTTAAATAGAAACATTAAATTTTCACATATTTTTTTAATGAAAAG
TGCTGAATTGCTTTTACAACAGGATGAAATTGAAAGCTTAACAACCAGACAAAAAAGTAT
AAAAGCTTAGATGGCTTAAATTGCTTAATTATAAAGCAGATATTAGGAATATTAAGATTT
TTTGCATGCACTTGATATTCTTATCCCTATTTTAATTTAGCTTCTTGGTTCCAAGAGTGT
CTATGATGTTTTAGAAACTATTAGACTTTTGATGTACTTAAAGAAGTATAACATCACAAC
TAGCGAGCTTGGTATTAAGAAAATGATAGTTTTAATTTGGTCAAAGGAAAAAGCTGTCAA
AGAAGAAGTTATGCAAACATATTGGTCTATATACATGAATAATAAAGTAAAAATTATTAT
TAAAATCTGTAAAATTTTATCAATTTATAAATTATTTTAGGAACAAAAGCCTTAGAGAAT
CGCTAAAAATTTGATCAATTTGATGATAGATACTAACATAACTGAAGCTTCTAGCTTTGA
AGAATTGCTCTTAAGCATGATGGACACACATAAGATATCTTAAGAAGAACTTAAAAGCTA
GAATCTTAAGGCCTATCCTATTCAAGATTAGGTTTTTGCTGAAGTTTGGGAAATATTCAC
TAAAAATTTTAGACGTTTATGTGAAGCTGATCCTAACCGTGAAAGAACTGAGCAAGAAAG
TTTAGAATATGAAAAAGAACTTATTTTACAAAAAAAAGAGATGAGAAGTGCTATTCAAAT
TCTTCGTATTATCAGTAGCAGATAAAAGAGCAATTGGAGCATGAAACTTGAAAGCTTTAA
GAGTAATTTAGAAATTTGATTTAATTATTTTAAATTAATATTAAATTTAACAAAAGACAT
CCTCAATTACTATAAGAAATTCGTCAATAAAGTTGACTGGGTTATTGTCAAAGAAATTGC
TTGCATTTCAGAATAGGTAAAATCAGAAGATAACAAGGCTATTATTGAGTCTATTGCTCA
AATTTTAACAGTTCTTCTAATCAGGGGTCACGGAACTGAAGATTCTGAGTGGTTCTTGTC
ATGTGAACAGATCATCAGATTGACATTTTTAACATTTACAAACCCAGAAACTATCATAAA
ATATTTAATTAAAAAAATGAGCCAATTTTTGTTTGAAAAGAAAATTGCTAATGAAGGTGG
TGCTGTTGATGAAGAAGAAGATGAACCTAATTAGAATAAAGATGACTTAGAAATGCAGCT
TGAGAAAGATAACAAAAAGGATGATGGAGTTTAAAAGCCTCTTACAAGCAAAGCCTATGA
GCATAAGCTAGCTCAAGTCTTGTACGTTGCAGGTAATAGTGCATTAAAATTCTTGATGCA
TTGTGATAGAATCGAAGAATATTTGAATAAACGTAGAATAGAAGCTGAAAACAACAAATA
GAAGGAAATGTAAAATGATGCTAATGACAATGAAGATAAAGACATAGGTAATTTGTTTAT
ATTTTTAAAGAGCTTTTGATTAAAATTGGTCATTTATTTTCTATTTAAAGATAAGATCAA
TGGAGGTTTCGAGGCTGAATTTGAAGAACATCAAAGAACTTTGCATAGTATTTAGGATAA
ACTCATCATCGAGTCTCCAATTTATAGCTACTTCTGTAGTATCGCAACAAAAATATGTTG
GAATATGTTCAATTCACTAAGTTTAGCTCAAAGAAGCGAAGCAGATAATATCAATAATAA
ATTAAGAAGAAATGTTATTTTGGACAGAGTTGCAATGCTATGTTTAATTAAATTTATGTG
TGTTTCCTCTTAAGTATGTAAGAAAAATCTTGATTTAATTTTCAATATGTTGGAATCTTA
AGCTGATGCAATCGTTAAAACAAATATCTTAATTGGTATTGGTGACCTCTATCATAGATA
TCCTATCATACTTGAAAGATACTTACACTTTGTCTACAAGTCACTTTCTGACAAAGATGT
TAGAGTTAGAAAGACCTGCTTGATGGTTATAACTCACTTAGTGCTTAACGATATGCTTAA
GGTCAAAGCTGAAATCTCCTCTATTGCAATTCTAATTGAAGACTCTGATTAGAGGTATAT
CTAATATTTTATTTCCATTTAATTTATTTATTTACAATTAAAAATAATTTACCAAGAATT
CAAAATATGGTTAAGTTATTCTTCCATGAGTTGAATAAGAAAGATCCCAAGGCTATTTAC
AATTTGTTGCCTGAATTGATTGGCAGATTATCTACTGAGAATATTAATGAGTCTATCTTT
AATAACTTTTGTGAAAATGTGTTACCACATATCGATAAGGATAAATAAGCAGAGTCTCTT
GTTGATAAACTTTGCTAACGTTTCACTTTAGTTAACACTGAAAAGGAATGGATTAATATC
TCTCATGCTCTTAAAATGTTCTCGTACAATGAAAAGAGCTTAAAGAAACTATTGGAACAC
TTTGAATCTAAATATAGAGAGAAATTGAATATTCCCATTATTTTAGAAAACTTCAAGGCA
ATAATCTTAAAAACCAAAAAAATGCCTCGTTAATCATAGGAGTAAAAGCAATTAATTGAT
GAACTTGACAGCAAAATATCTAATTTCAAAAAAGAGACTTTTGATGATAAAAAATACAAG
AAAGAGAAGCCTAAACCCAAACAAGCAGCTGGAACTAAAGGAAACTAAGCTAACAAAGGA
GCTGTAGGAAATGCCTAAAAGAAAGGAAAATAAAATGTTTAAGTACCCAATCCATAATAA
TCAAAGAAAGGTTAATAGTAAATGATGGAAATTGAGTCTGATGAAGAAGAAGAAGCTGTA
TTTTAACCTAATAGAAGATCTCAACAATAACAACAGCAACAGCTTCGTGGAGGACCTGGT
AAAATTTTAAAATCTAATTTGGAAGAAGTGAAAAATGTTAAGAATGCTTTATTAGCAGCC
AACCATCCAAATAACTAAAGGAACACCAAATAAAGGGCTGAACCTGAAGAAATTGATATT
GAAGATGATGATTTTGATGAAGAGGAGGAAGAAGAGTTTGTTGGACATAACAGAGGTTAA
TCTAGCAGAGCTTAATAAAGTAATTAAAGAGCATCATCAAGAAATGTACAGAGAAAATCG
TTGAAAGAAGATTCAGATGATGATGACTTTGATGAGGAGTTTTGA