Identifiers and Description

Gene Model Identifier

TTHERM_00382220

Standard Name

CPAP1

Aliases

PreTt10379 | 40.m00264

Description

T-complex protein 10 carboxy-terminus containing protein; T-complex protein 10 C-terminus containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03789 ) ELK domain
  • ( PF02370 ) M protein repeat
  • ( TIGR01612 ) rhoptry protein
  • ( PF07661 ) MORN repeat variant
  • ( PF04702 ) Vicilin N terminal region
  • ( PF08641 ) Kinetochore protein Mis14 like
  • ( PF07202 ) T-complex protein 10 C-terminus
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR01396 ) flagellar basal-body rod protein FlgB
  • ( TIGR00690 ) DNA-directed RNA polymerase, omega subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00382220

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00047.19.997093137033517e-262hypothetical protein (1699 aa)
OxytrichaContig16064.0.g675.998886722426197e-42T-complex protein 10 C-terminu
s
Stentor CoeruleusSteCoe_96412.3195228302435696e-16

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00382220(coding)
ATGGGAGATTAGTCTTAGTCTTAAGATAGAAGCTTTTAGAGTATGATGAACCCTAATAGC
TTTAATATAAATTAAGGATTTCCTCAGCAAATGATGAATTTAGATAACAGCATGATGAGT
GCTGGAGGAGGAAATAATTAAGCAACATCTTAAATGTTTGATATGGTTAATAATATGTTT
AAAATGATGATGATGAACTAAAACGGCGGACAATTTAATCCAAACGCTCTTCAAAGCATG
ATGAGTTAATATACCAGTAATATGAATAACAGCAATATAGGAGGAATGAATATGAACAGT
GCGAATAGTTAGCAAATGGGTGCTAATTTATTCTAAAATAATATTTAGCCATAGTAATAT
CAATCATAACAACAACTATAACCATAGCTTAAACAAAATAGCAATGTTAATTTAAATAAC
ACAATGACTAGAGAAAATATCGATACTGCTTTTAGAAGTATGGAAGACAGATTCTTCAAT
CAGTAAAATGACTTACAGAGTTTTTATGATAAACTTCAAAAGTCGAATTAATCACCAATA
GGGATTAGCAACAATCAATAAAATAATAATAGCTAAAATCCTAACATGCTCAATAAGAAA
AGCAATAATATTATGAATAATAATCCTTAAATTACTGGAAATAATAGCAGTAACTTGTTT
GATCTTTCCGGTTTTTCAGAATAGTAGCTTTAATCTAAATCGGAGTTTGTAGAATATGAC
AATAACTTTGATCAATCTTAAAATTTCAATCATTTTTAGTCTTCCAATAAGTAGAGCTTT
GTTGGAAATTAAAATCTTAGAGGATAGGCTGGCTAGAATAAGGAAGAAGATAATGATTTA
TTTAACAAAAATTATAATTAAAAAGGAATTATACCTGGTAACGGAAGGAGCGAAGATGTT
ATGTATAACACTTACAACTAAGATAGAAACATAGGCAATATGTATAATGATAGAAAAGCA
GTTAATTTAAATAATGAGAGACCAGTTAACCAAAATAATATCAGGAATAGTCAAATGCCA
AATAAGTTTGAGGAGAAACCATACAATGCAGAAAATATAAATCCATCATCTGTATTGGGG
GATGATAATGAATTCTTAAGAGATAGCATCGTAAATATGCATTAAAATCAAGCATTGAAT
TAATATCCAAGAAACTAGTAAAATGTTAATAAAATGAATAATTATGAAAATGAATACTAA
CAAAAAGAAAAAGTAAACCAAAAATAGTTCAATTCTAATGCTCTATCAGATAATGATTAG
CAATATTTAATGAGTAATTTGAAGGTAAGAGGGAACAATTAAAATAATGATGATAGTAAA
TTTAATAGAGGTTAGATGGAGAATATGCATCCTCCTCTCTCAACTAAAAGTTAATATCAA
AATAGACCATATGACATCAATTAGGAAGAAGAAATAAATTAATATCTCCCTATTCAGAGT
AAAAATAGTAGATAAAATTTTGTTGATGACGAGAGACCTATCAAAGGGGCAAGGAATTAA
ACAAATCCATATAAAGATCAATTCGAGCAGTAAGATGATAGTTTCCCTCCTCAAAAATAT
ACTCAAAATAAAAATAGTTAAATATAGAATAAAATAAATAATTATCAAGAATTAGACCAA
CCAATTAAATCTCAAAAAAACAATTATTTCAATGATGAAAGACCTATTTAGTCCTAAAAA
AATAATTAAAACAAACACTTTATTGATGATGAGGATGAAAGACCTATCTAGTCTTCTAAA
AATTAGTTTAAAAATAATAATTAAATGGGAAACGAAAGCGAACATCATCAGTAAAATTTT
AATACATCTAGAAGCTTTAATCCTATTGAAGAAATCCCTATAAAATCTAAAGCAGGGTTT
AGGAATTTTGAAGATCTTATTGAAGAAAAAATGAGAGAAGAAGGTTAAGATGATTTTTAG
GATTACAATGATAATAATGGGGGATAAGCAGGAAGCAGAAGATAAACTTTTTTAAAGAAA
GGTTCTAGAACATTTTTGTCTAACGCATAAAAGCGCTCAAAGGCAGCACAAAACCACATT
GAAGAAATAGGCAACCAATAAAAAGGAGATGTTATAGGTGGCAGTGCTAGTGTAACTAAT
ATTTAAAAACCTAAAAAAGCCACATCCAATAATTTTAAATCAGCTTCTTCTCTCTCAAAA
AATGAAGGTTTTGGTGGTTCTAATCAAAATAATTTTAATGAGAAACCTGTTGGAGGCTCA
AATAAGCTAAATTAAATTCACAGCACAGGAGGATTAGATAGCTTAAATTAAATCTCTTCG
AATGTAGATATTACTGACAAAGCAAATGGTCCTAAAGAAAAAAAGAAATTTTTGTAAAGA
GGTTAAGGCAAAGGAGGTGGCATACAAGGATTTAAAAAGGAAGAATAAGCGAATACTTAA
TCCTCTAGTTAAATCAAAGATATTAATGATAAGCCACCATAAAATAGCAGCACTAATTAA
CAAAAGAAAAATGATAAAAAACCATAGCAGCAGAAGCAAAAAAAAAATTCAGATCTTATT
TCTTTAGATGATGAAGATGACTACAATCCTAGAAACCTCAAGAAAAAGAGAAAGGAAAGT
AACGAAGAATATGATAATAAAGACGATTTGAATGATGATCAAGAAGAAAATGAGTTTGGT
GGTAAAAAGTACCAGCCTTTTAAGTATCTACAAGATAATTAAGATGATAAAGATGAGGAA
GAAAATGAATATGCACAGAAGATTAATAAAAATTCAAGACCTCCAACCAGCTTAGCAAGC
ATTTAGAATAAAGCAGTAAGGAAGGATAGTGAAGAAAATAAGAATAAAATTCATAAGAGT
GAAGGAGCATATCAATTTGATGATGAAGAAGAGTGGGGTGACGAGGATCATAACAGAAAA
AATAACCAAATAAATAATAAAAATAAATTTAGCAAAAAAGAAGATGAAAAGAAGAGTAAT
AAATTAAATATTCATGACAGTGATGCAGGGTCAGAAAATAATGATGAAAATGAATTTAGA
GATGACAAATCAAACAACAACGATGATGAATTCAATGATGATCCAGATTAATAATATTCT
AAGGTGGTTTAAAAATATTTTAACAAAAAAGGAAACAATTAGAAAGGCTCTAATAGTAAT
TAATAAAAAATTTCTCCAGGTGGAATCTCTTTAAATGATTTAACTCCTGAATAAAAGAGA
TAGCTCATTCAAGAATTTACTAATGAATAAATTGAAAAATTGGACAGCGAAGTCAGTAAA
GTGAAGCTTGAAAATGAGAGAGTTAAAAGAATGAGAAGCAAATACGAAGATCTTCTTAAA
TCTTTTAATAAAGAAAAAGAGCAATTTGCTAAGTAAAAAGAGTTAGAAATCCAAGAATTA
GAAGAATGGAAAAAAGAAGAAAAAAAGAAGATTTAAAACGAAAAAAGAATTGCAGACAGA
TAGTAGAAAGCTATGCAAAATATGCCTAACAGAAAGGAAAGAGAAGAAATAGAAAATCTA
AAGGCGATGAATAAGAAATTGCAAGAAGAAATTAAAATAAAAGATTAAAGAAATAAACTA
ACCATTGATAGACAAAAGAAACTCATTGATGAGCTAACTTAAAAAAACTAAGAGCTTAAA
GATGAGATAAAGCATTTAGAGAATATGAGATTAGATGGAGGTGCTGGCTCTAATCTAAAC
AAATAAAATAATCTGAGCAGAACTAGCAGTTCTAAGTAACCACAAAAAGTTCCCACAAAA
TCTCCATTCAAATCTAAACCATCTAAAACAATTGTAGATGATGCTTATTAGAATGACATG
GATGAGGAAGAAAGTTTAGGCTATTCTCAAAACAATTAAAAAAATTAGATGAAAAAAAGT
AATGTAATGGGAGACTTCTAAAAGAAGAAGAATAAATCAATGAGTTCTAATTATGACTAT
TAATATGATAATAACACAGCAAAATACAACAATGAAGATGATAATTTTAAATACGATTAC
AACTATGATTAAGATGACAATTATGGAGAACATAACGATGAAGATGAAGATGCTTAGTTT
GAAAATTATGAGAACTACTAAAGAGATCCCTCCGTATCAAATGCTTCTAAGGGAAGTAAA
TAAGGATAAAAGAATAAAATTCATGCAGATGTTAGTCAAGATTATGAAAACAGCTATTCA
GGTAAAAAAGAAGAAGAAAATGAAGATGAACACTTGGAAACTTATGAAGATATTATAAAT
TTTAATCCTACCAGCCACACTTACAGCGAGAATAATAAAAAGTCTAAAATTGAGACCAAA
TAAAGTATAAATATAAAATAATAGCACAACTCAGATGTTCCTACTAGCACTAGCAATAGA
ATGAACTCGAAGAGTAATTCTATAAGTATTTAAAATGCTAATAATAGTGTTGGCAGTACT
AATACCGCCATGTCTAGTGTTTCTTCTGCTCATAAAAACGATAAAAAAAAATTGGTACAA
AATGAAAAAGAAAATAAATAATAAGTTGTATAAAATAGCAACAGCACATAATAAAAATAA
TAAATTTAATAAAAGCCTCAAAAATAATCAGTAAATTAGTAAAAGTAGTATAAATATGAC
ATTTCTACTCTATCTTAATGCAGAAATATTAGCATTAGATAAATTGGAGATGAAATATAA
AGAGAACAATTCCATTACGATCAAAACATATTTTATTAAAATGTCATTCAAAATTTAAAC
AATCCTTCTCACCCTGTCAGTGAAAACATTACAATGGATGGAAAAATACAAACTTTTTAT
GAAGATGGCAGGTAAGTTGTTTAGTTTGCTAATGGAGTTAAGCGTTAAGTTTTTCCAAAC
GGTTACACTTTAGTCAATTTTATCAATTAAGACGTTAAACAAGTTCTTCCTGATCATACA
GTTATTTATTACTTTGCTGATGCTCAAACCACTTAAACCACATTAACAAATCATATAAAT
ATTTATAATTTCCCAAGTAATCAAATAGAAATTCACTTCCCTTAAGGCAGAAAAGAAATA
ATTTTTGCTGATGGAACAGAAAAATATATTTATGAAGATGGCGAAGAAAAGACATTCTTT
GCAGATGGATCTATTTAAACAGTAGATGTAAATAAAGTGAAAAAAATTCGTTATAAGAAT
GGAAAAGAAGACGTAATTTATCCTGATTAAAACTCAGAAAATGTGCATTGA


>TTHERM_00382220(protein)
MGDQSQSQDRSFQSMMNPNSFNINQGFPQQMMNLDNSMMSAGGGNNQATSQMFDMVNNMF
KMMMMNQNGGQFNPNALQSMMSQYTSNMNNSNIGGMNMNSANSQQMGANLFQNNIQPQQY
QSQQQLQPQLKQNSNVNLNNTMTRENIDTAFRSMEDRFFNQQNDLQSFYDKLQKSNQSPI
GISNNQQNNNSQNPNMLNKKSNNIMNNNPQITGNNSSNLFDLSGFSEQQLQSKSEFVEYD
NNFDQSQNFNHFQSSNKQSFVGNQNLRGQAGQNKEEDNDLFNKNYNQKGIIPGNGRSEDV
MYNTYNQDRNIGNMYNDRKAVNLNNERPVNQNNIRNSQMPNKFEEKPYNAENINPSSVLG
DDNEFLRDSIVNMHQNQALNQYPRNQQNVNKMNNYENEYQQKEKVNQKQFNSNALSDNDQ
QYLMSNLKVRGNNQNNDDSKFNRGQMENMHPPLSTKSQYQNRPYDINQEEEINQYLPIQS
KNSRQNFVDDERPIKGARNQTNPYKDQFEQQDDSFPPQKYTQNKNSQIQNKINNYQELDQ
PIKSQKNNYFNDERPIQSQKNNQNKHFIDDEDERPIQSSKNQFKNNNQMGNESEHHQQNF
NTSRSFNPIEEIPIKSKAGFRNFEDLIEEKMREEGQDDFQDYNDNNGGQAGSRRQTFLKK
GSRTFLSNAQKRSKAAQNHIEEIGNQQKGDVIGGSASVTNIQKPKKATSNNFKSASSLSK
NEGFGGSNQNNFNEKPVGGSNKLNQIHSTGGLDSLNQISSNVDITDKANGPKEKKKFLQR
GQGKGGGIQGFKKEEQANTQSSSQIKDINDKPPQNSSTNQQKKNDKKPQQQKQKKNSDLI
SLDDEDDYNPRNLKKKRKESNEEYDNKDDLNDDQEENEFGGKKYQPFKYLQDNQDDKDEE
ENEYAQKINKNSRPPTSLASIQNKAVRKDSEENKNKIHKSEGAYQFDDEEEWGDEDHNRK
NNQINNKNKFSKKEDEKKSNKLNIHDSDAGSENNDENEFRDDKSNNNDDEFNDDPDQQYS
KVVQKYFNKKGNNQKGSNSNQQKISPGGISLNDLTPEQKRQLIQEFTNEQIEKLDSEVSK
VKLENERVKRMRSKYEDLLKSFNKEKEQFAKQKELEIQELEEWKKEEKKKIQNEKRIADR
QQKAMQNMPNRKEREEIENLKAMNKKLQEEIKIKDQRNKLTIDRQKKLIDELTQKNQELK
DEIKHLENMRLDGGAGSNLNKQNNLSRTSSSKQPQKVPTKSPFKSKPSKTIVDDAYQNDM
DEEESLGYSQNNQKNQMKKSNVMGDFQKKKNKSMSSNYDYQYDNNTAKYNNEDDNFKYDY
NYDQDDNYGEHNDEDEDAQFENYENYQRDPSVSNASKGSKQGQKNKIHADVSQDYENSYS
GKKEEENEDEHLETYEDIINFNPTSHTYSENNKKSKIETKQSINIKQQHNSDVPTSTSNR
MNSKSNSISIQNANNSVGSTNTAMSSVSSAHKNDKKKLVQNEKENKQQVVQNSNSTQQKQ
QIQQKPQKQSVNQQKQYKYDISTLSQCRNISIRQIGDEIQREQFHYDQNIFYQNVIQNLN
NPSHPVSENITMDGKIQTFYEDGRQVVQFANGVKRQVFPNGYTLVNFINQDVKQVLPDHT
VIYYFADAQTTQTTLTNHINIYNFPSNQIEIHFPQGRKEIIFADGTEKYIYEDGEEKTFF
ADGSIQTVDVNKVKKIRYKNGKEDVIYPDQNSENVH


>TTHERM_00382220(gene)
ATGGGAGATTAGTCTTAGTCTTAAGGTACTGAATTTTTTAGTGTTGTTGTAGAATTATAA
TAAATTATTTAGAGTTTTTTAAGCATATTATTTGCAATTTTTAAAATTTAATTATAGATA
GAAGCTTTTAGAGTATGATGAACCCTAATAGCTTTAATATAAATTAAGGATTTCCTCAGC
AAATGATGAATTTAGATAACAGTAAATAAATCAAAAAATAGCAAATAAAAATTAGATTAT
ATTTTTAATATTACAGGCATGATGAGTGCTGGAGGAGGAAATAATTAAGCAACATCTTAA
ATGTTTGATATGGTTAATAATATGTTTAAAATGATGATGATGAACTAAAACGGCGGACAA
TTTAATCCAAACGCTCTTCAAAGCATGATGAGTTAATATACCAGTAATATGAATAACAGC
AATATAGGAGGAATGAATATGAACAGTGCGAATAGTTAGCAAATGGGTGCTAATTTATTC
TAAAATAATATTTAGCCATAGTAATATCAATCATAACAACAACTATAACCATAGCTTAAA
CAAAATAGCAATGTTAATTTAAATAACACAATGACTAGAGAAAATATCGATACTGCTTTT
AGAAGTATGGAAGACAGATTCTTCAATCAGTAAAATGACTTACAGAGTTTTTATGATAAA
CTTCAAAAGTAATAAAAAATATTAAATTTATTTATCTATTTGTTTATTCTACATTTAAAG
TCAAGAAATATAAAATTCATTAATAGCTTACTTACTTTTAAGTTGAATGTAGTAGTTTAT
TAAAATTTATTTAATTGTTTTTATGGAAATAATTTTAATTAATAAATTAATTAATTATAG
GTCGAATTAATCACCAATAGGGATTAGCAACAATCAATAAAATAATAATAGCTAAAATCC
TAACATGCTCAATAAGAAAAGCAATAATATTATGAATAATAATCCTTAAATTACTGGAAA
TAATAGCAGTAACTTGTTTGATCTTTCCGGTTTTTCAGAATAGTAGCTTTAATCTAAATC
GGAGTTTGTAGAATATGACAATAACTTTGATCAATCTTAAAATTTCAATCATTTTTAGTC
TTCCAATAAGTAGAGCTTTGTTGGAAATTAAAATCTTAGAGGATAGGCTGGCTAGAATAA
GGAAGAAGATAATGATTTATTTAACAAAAATTATAATTAAAAAGGAATTATACCTGGTAA
CGGAAGGAGCGAAGATGTTATGTATAACACTTACAACTAAGATAGAAACATAGGCAATAT
GTATAATGATAGAAAAGCAGTTAATTTAAATAATGAGAGACCAGTTAACCAAAATAATAT
CAGGAATAGTCAAATGCCAAATAAGTTTGAGGAGAAACCATACAATGCAGAAAATATAAA
TCCATCATCTGTATTGGGGGATGATAATGAATTCTTAAGAGATAGCATCGTAAATATGCA
TTAAAATCAAGCATTGAATTAATATCCAAGAAACTAGTAAAATGTTAATAAAATGAATAA
TTATGAAAATGAATACTAACAAAAAGAAAAAGTAAACCAAAAATAGTTCAATTCTAATGC
TCTATCAGATAATGATTAGCAATATTTAATGAGTAATTTGAAGGTAAGAGGGAACAATTA
AAATAATGATGATAGTAAATTTAATAGAGGTTAGATGGAGAATATGCATCCTCCTCTCTC
AACTAAAAGTTAATATCAAAATAGACCATATGACATCAATTAGGAAGAAGAAATAAATTA
ATATCTCCCTATTCAGAGTAAAAATAGTAGATAAAATTTTGTTGATGACGAGAGACCTAT
CAAAGGGGCAAGGAATTAAACAAATCCATATAAAGATCAATTCGAGCAGTAAGATGATAG
TTTCCCTCCTCAAAAATATACTCAAAATAAAAATAGTTAAATATAGAATAAAATAAATAA
TTATCAAGAATTAGACCAACCAATTAAATCTCAAAAAAACAATTATTTCAATGATGAAAG
ACCTATTTAGTCCTAAAAAAATAATTAAAACAAACACTTTATTGATGATGAGGATGAAAG
ACCTATCTAGTCTTCTAAAAATTAGTTTAAAAATAATAATTAAATGGGAAACGAAAGCGA
ACATCATCAGTAAAATTTTAATACATCTAGAAGCTTTAATCCTATTGAAGAAATCCCTAT
AAAATCTAAAGCAGGGTTTAGGAATTTTGAAGATCTTATTGAAGAAAAAATGAGAGAAGA
AGGTTAAGATGATTTTTAGGATTACAATGATAATAATGGGGGATAAGCAGGAAGCAGAAG
ATAAACTTTTTTAAAGAAAGGTTCTAGAACATTTTTGTCTAACGCATAAAAGCGCTCAAA
GGCAGCACAAAACCACATTGAAGAAATAGGCAACCAATAAAAAGGAGATGTTATAGGTGG
CAGTGCTAGTGTAACTAATATTTAAAAACCTAAAAAAGCCACATCCAATAATTTTAAATC
AGCTTCTTCTCTCTCAAAAAATGAAGGTTTTGGTGGTTCTAATCAAAATAATTTTAATGA
GAAACCTGTTGGAGGCTCAAATAAGCTAAATTAAATTCACAGCACAGGAGGATTAGATAG
CTTAAATTAAATCTCTTCGAATGTAGATATTACTGACAAAGCAAATGGTCCTAAAGAAAA
AAAGAAATTTTTGTAAAGAGGTTAAGGCAAAGGAGGTGGCATACAAGGATTTAAAAAGGA
AGAATAAGCGAATACTTAATCCTCTAGTTAAATCAAAGATATTAATGATAAGCCACCATA
AAATAGCAGCACTAATTAACAAAAGAAAAATGATAAAAAACCATAGCAGCAGAAGCAAAA
AAAAAATTCAGATCTTATTTCTTTAGATGATGAAGATGACTACAATCCTAGAAACCTCAA
GAAAAAGAGAAAGGAAAGTAACGAAGAATATGATAATAAAGACGATTTGAATGATGATCA
AGAAGAAAATGAGTTTGGTGGTAAAAAGTACCAGCCTTTTAAGTATCTACAAGATAATTA
AGATGATAAAGATGAGGAAGAAAATGAATATGCACAGAAGATTAATAAAAATTCAAGACC
TCCAACCAGCTTAGCAAGCATTTAGAATAAAGCAGTAAGGAAGGATAGTGAAGAAAATAA
GAATAAAATTCATAAGAGTGAAGGAGCATATCAATTTGATGATGAAGAAGAGTGGGGTGA
CGAGGATCATAACAGAAAAAATAACCAAATAAATAATAAAAATAAATTTAGCAAAAAAGA
AGATGAAAAGAAGAGTAATAAATTAAATATTCATGACAGTGATGCAGGGTCAGAAAATAA
TGATGAAAATGAATTTAGAGATGACAAATCAAACAACAACGATGATGAATTCAATGATGA
TCCAGATTAATAATATTCTAAGGTGGTTTAAAAATATTTTAACAAAAAAGGAAACAATTA
GAAAGGCTCTAATAGTAATTAATAAAAAATTTCTCCAGGTGGAATCTCTTTAAATGATTT
AACTCCTGAATAAAAGAGATAGCTCATTCAAGAATTTACTAATGAATAAATTGAAAAATT
GGACAGCGAAGTCAGTAAAGTGAAGCTTGAAAATGAGAGAGTTAAAAGAATGAGAAGCAA
ATACGAAGATCTTCTTAAATCTTTTAATAAAGAAAAAGAGCAATTTGCTAAGTAAAAAGA
GTTAGAAATCCAAGAATTAGAAGAATGGAAAAAAGAAGAAAAAAAGAAGATTTAAAACGA
AAAAAGAATTGCAGACAGATAGTAGAAAGTAAAAATATTTAAAAGATTCATAAATCACAT
TTATTTAATAATTTTTTTACTTATTTATTTATATTTAAAATATTTAATTTAAGGCTATGC
AAAATATGCCTAACAGAAAGGAAAGAGAAGAAATAGAAAATCTAAAGGCGATGAATAAGA
AATTGCAAGAAGAAATTAAAATAAAAGATTAAAGAAATAAACTAACCATTGATAGACAAA
AGAAACTCATTGATGAGCTAACTTAAAAAAACTAAGAGCTTAAAGATGAGATAAAGCATT
TAGAGAATATGAGATTAGATGGAGGTGCTGGCTCTAATCTAAACAAATAAAATAATCTGA
GCAGAACTAGCAGTTCTAAGTAACCACAAAAAGTTCCCACAAAATCTCCATTCAAATCTG
TATTTGTTGTTTAAAATTATTAATAATTAGAAAATATTGAAAAAACATAAGTTAAAGTAA
TATTTTTATATAAATAGAAACCATCTAAAACAATTGTAGATGATGCTTATTAGAATGACA
TGGATGAGGAAGAAAGTTTAGGCTATTCTCAAAACAATTAAAAAAATTAGATGAAAAAAA
GTAATGTAATGGGAGACTTCTAAAAGAAGAAGAATAAATCAATGAGTTCTAATTATGACT
ATTAATATGATAATAACACAGCAAAATACAACAATGAAGATGATAATTTTAAATACGATT
ACAACTATGATTAAGATGACAATTATGGAGAACATAACGATGAAGATGAAGATGCTTAGT
TTGAAAATTATGAGAACTACTAAAGAGATCCCTCCGTATCAAATGCTTCTAAGGGAAGTA
AATAAGGATAAAAGAATAAAATTCATGCAGATGTTAGTCAAGATTATGAAAACAGCTATT
CAGGTAAACAATTAAGAATAATTTTTTTAATAAATTTTAAAGGAACCTTAAAATTAAAAA
TTGTTAATTTGCTTTTAAAATATTTTCATAAAGCGAGTTTTATCAAAATAGAAATAAATG
AATAAATTTAATTAAATTTTCTATTAAATTAGCAAATTTTATCAATTAAATTTAAACACT
TTTTATTTAATATTAATTTATTTTTTAATAAAAATATTAGGTAAAAAAGAAGAAGAAAAT
GAAGATGAACACTTGGAAACTTATGAAGATATTATAAATTTTAATCCTACCAGCCACACT
TACAGCGAGAATAATAAAAAGTCTAAAATTGAGACCAAATAAAGTATAAATATAAAATAA
TAGCACAACTCAGATGTTCCTACTAGCACTAGCAATAGAATGAACTCGAAGAGTAATTCT
ATAAGTATTTAAAATGCTAATAATAGTGTTGGCAGTACTAATACCGCCATGTCTAGTGTT
TCTTCTGCTCATAAAAACGATAAAAAAAAATTGGTACAAAATGAAAAAGAAAATAAATAA
TAAGTTGTATAAAATAGCAACAGCACATAATAAAAATAATAAATTTAATAAAAGCCTCAA
AAATAATCAGTAAATTAGTAAAAGTAGTATAAATATGACATTTCTACTCTATCTTAATGC
AGAAATATTAGCATTAGATAAATTGGAGATGAAATATAAAGAGAACAATTCCATTACGAT
CAAAACATATTTTATTAAAATGTCATTCAAAATTTAAACAATCCTTCTCACCCTGTCAGT
GAAAACATTACAATGGATGGAAAAGTAAATTAAAATATAAAAAATGATTATTTATTTAGA
TTTTTAATAGTATTATAGCTTGTTTTATTTAAATAAATAATTATATTTAATTAGATACAA
ACTTTTTATGAAGATGGCAGGTAAGTTGTTTAGTTTGCTAATGGAGTTAAGCGTTAAGTT
TTTCCAAACGGTTACACTTTAGTCAATTTTATCAATTAAGACGTTAAACAAGTAAAATTA
TTTTAATGAATAGCATTATTTAAGCTTAAAATTTTATAGGTTCTTCCTGATCATACAGTT
ATTTATTACTTTGCTGATGCTCAAACCACTTAAACCACATTAACAAATCATATAAATGTA
AATTTAGATTGTTTGTTTTTAAGGTCTTTAAATTAAACTTTTAAAATTAATTTATAGATT
TATAATTTCCCAAGTAATCAAATAGAAATTCACTTCCCTTAAGGCAGAAAAGAAATAATG
TAAATTTAGCTAAAAATAATTTTAAAAGCGTTTATATAATTTTTTATTAAACCGAAAAGT
TTTGCTGATGGAACAGAAAAATATATTTATGAAGATGGCGAAGAAAAGACATTCTTTGCA
GATGGATCTATTTAAACAGTAGATGTAAATAAAGTGAAAAAAATTCGTTATAAGAATGGA
AAAGAAGTAAGTTTAATTATTTGTTAGAAAGAAAGAAATAACTAATACAAATATTTAAAA
AAAGGACGTAATTTATCCTGATTAAAACTCAGAAAATGTGCATTGA