Identifiers and Description

Gene Model Identifier

TTHERM_00488350

Standard Name

COP1 (beta subunit of the COP coatamer complex; )

Aliases

PreTt08338 | 60.m00135

Description

Adaptin N terminal region family protein; coatamer (COP) beta subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF03789 ) ELK domain
  • ( PF02985 ) HEAT repeat
  • ( PF01602 ) Adaptin N terminal region
  • ( PF07718 ) Coatamer beta C-terminal region
  • ( TIGR00741 ) ribosomal subunit interface protein
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( PF08752 ) Coatomer gamma subunit appendage domain
  • ( TIGR01716 ) transcriptional activator, Rgg/GadR/MutR family, C-terminal

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00488350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13523.19.997093137033517e-262adaptin N-terminal region fami
ly protein (954 aa)
OxytrichaContig21140.0.g1034.999394169176705e-180Adaptin N terminal region
DictyBaseDDB_G02847351.9992336839414155e-150copB on chromosome: 4 position
2394561 to 2397811
WormBaseWBGene000212929.996472444528484e-132locus:copb-1 Coatomer subuni
t beta status:Confirmed Un
iProt:Q9TYL9 protein_id:CCD6
1981.1
SGDYDR238C9.998919090800975e-129SEC26 Essential beta-coat prot
ein of the COPI coatomer, invo
lved in ER-to-Golgi protein tr
afficking and maintenance of n
ormal ER morphology; shares 43
% sequence identity with mamma
lian beta-coat protein (beta-C
OP)
Stentor CoeruleusSteCoe_218078.074506789675094e-73

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00488350(coding)
ATGGCATCAGCAAATATATAATAAGCTAGCGAGCACAAAGAACGTTATTGTAGCATTTAT
ATTAGAGCTGAATAAGAGCAGCTCACTCCTTAAGAAATTAAGACTCTTCTTATGGGAAAA
TATGAAGAAAAGATTAAAGGTCTTAAGTCCCTCATTTATGCAATTATTCAGGATGAGAAT
TTTGATAAATTGACCATGACTATTATAACTTACTTGGTTCCTTATCAAGCTGAAAACCAT
GACCTCAAGAAGATTTTGTTGTACTACTGGGAAATCATTGAGAAGGTCAATAAAGATGGT
AAGCTTAAAGACGAAATGATTTTAGTTTGCAACAGTTTGAGATCAGACTTGTTGCATCCA
AACGAGTATTTAAGAGGAAGAACTCTTCGTTTGGTTTCAAGAATTATGTATAAGGGTATT
TTAGAGCCTTTAATTTCAAGTATTATGGAAAGCTTAAATCACAAGCACACTTATGTTAGA
AGAAATGCTATTATCGCTATTTACTAAATATTTTTAAATTTCGGTGATGATCTGATTAAT
GATATCGATACTGAAATGGAAAAGGTCCTCTAAAACGAAACTGATTTGTCAACCAAAAGA
AACGCTTTCCTACTTCTTTATCATACCAACCTTGAGAAAGCTATGGCTTACCTCTATTAA
ATTATTTAAGATGATAGAGTTGACGAAATGGGAGACATCATGCAACTTTCAGTCTTGGAA
CTCTTTAGAAAAACTTGCAAATATGATCCTAGCTAGAAATCTAAGCTTATGAAATGCATT
TTATTCTTCTAAAAATCCCGTAGTCCTTCTGTTTAGTTTGAGTGTGCTAATACTTTAATA
TAAATATCTAATACACCTACAACTTTGAAGTTAGCCACTAATATATATGTTTAACTATTG
TTAAATAACTCAGAAAACAATGTTAAAATGGTAGTTCTTGATAAAATTTAATATATTCTC
AATATTGAACCTAAATATCTTGAAGAACAAGTTATTGAAATTACTAAAGTATTGAACAAT
CCTTCTAACTAAATTCGTAAAAATGCCATTGATATTATTTCAAGCTTAACTAACTCTAGA
AACGTCAGCTATATCTTCCCTAAGGTTGTCAAAGAAGTAAAGAAGACAATTTCTGAAGAA
AATGGAAAGGAATTTACTAAGATTCTTCTTGATTTTGTTGAGTACTGCGTTTTTAACTTT
GAAAGCGTTTTAGACGATGTTATGAATTTGATCAACGAAGTATTCTTAACTAACAGTGGC
TTAAAACAAAAAACTTAAGATCAAGTAAAAAGAATCCTTACTGGAATTGTTACAACCTAT
CCTCAAAGCAGAGAGCGTTTGATGTCAAAGTTGTTAGAAAGATTTAGAGACATCTCATCT
CCTTACATATACAATGGTGTTCTCTGGATTCTTGGTGAATACTCCTCAGGAGAATAAGTC
ACCCGTAGCTTAGATTAAATCTTAGAAGCAATTGGTTCACTTCCAATCACCTATGTTTAA
TAAACTACCGACGACCAAAAGTCAGAAGAAAAAGAAGCACCTAAACCTACTTAAAAAAAA
TACAAAACAGTCATTTTAGCTGATGGTAGCTATGGTACTGAAGTAATTGAAGAAAAGGAA
GCAAGAAAATAATCAGTTGATGCTAGTGAACAACAAGATTCTTAATTCAGAATTATTCTT
TCTCAATATTCTTACATAGGTAGTATTGCTGCCCGTACTTTACTAAAGCTGGTTTTCAAG
ATCAAGCTTGATGCTAAGAAATACAACAAGTACACTAGCTAAATTTTGTTAGTTTTCTGT
TCTTTGATTAGATTGTACACTGCTAAGCAAAGCAAGAAGAATGAAGAATATGATTTAGAT
TCTCTTGAAAAAATATACCTTGGTGTTAAGTTATTGACTGAGCCTAAGAAGTTTGTAAAT
GAAAAGATTTAATGGTTAGAAAGCAATGAAAATATTGTGAAGCACAAAGAGAAATTGACA
AAGAGAACTGATCTTGAACAATAAAGAGAAGAAAAGAAAGATTCACATATTGCCAAATAG
CCTGATGATTTAATTGTTATTAGAGCCTTGAAGGGTAAGCAAGCAGAAATTGGTGATTTA
GATTTGTAGGATGAAGAAATAAATTAAATAGAATTTAAAGGAGTTGGAGAAGACAATGAT
TTTGCAAGCAAATTAAATAAATTGGTCTAATTAACTGGATATAGTGATCCAATTTATGCT
GAATCATTTGTTTACATTCATAAATATGATATTTAATTCGAAACTTTGTTAATAAATCGC
ACAACCAAGCCCTTACAAAAAGTTCAAATAGAATTCTTCACTCAAGAAAATGATTAAAAG
AGAGTAATTGAGAAGGCATAGGCTGTAACCTTATAACCTAACTAAAGTGCTTATGTAAAA
ACTTCTCTTAAATTCACCTCAATAGATATAGGAGTTATTTTCGGTGCCATCAACTACGAA
AATATTGCTGGTATTGAACAAGCTTATTTAATCACTAAAGAAATAGATATTGACCTAATT
GATTTCGTATATCCTGCAGAAATAGATTTTAATTCTTATAGAGAAATGTGGGCTAAGTAT
GAATGGGAAAACCGTATTGTCATCAATCCTCAAAAGATCGAGATGTTATAATTCTTCCTC
TAATTCAAAGAATAATTTAAATTATATATGCTTAACGACGAAGAGGAAATCAAAAATGCT
ACAGTAATTTGTGTCAATTTCTATGCTAAGACCAAGCTAGGTGATGATTTCCTCATAAAC
ATCAGCGCAGAGTCTCAAAATGGTTCTGTTACAGGAACAATTAGAATCAGAAGTAAAGTT
AAAGGTGTAGTTGTAAGCATAGGATAAAAATATAGGTAATGA


>TTHERM_00488350(protein)
MASANIQQASEHKERYCSIYIRAEQEQLTPQEIKTLLMGKYEEKIKGLKSLIYAIIQDEN
FDKLTMTIITYLVPYQAENHDLKKILLYYWEIIEKVNKDGKLKDEMILVCNSLRSDLLHP
NEYLRGRTLRLVSRIMYKGILEPLISSIMESLNHKHTYVRRNAIIAIYQIFLNFGDDLIN
DIDTEMEKVLQNETDLSTKRNAFLLLYHTNLEKAMAYLYQIIQDDRVDEMGDIMQLSVLE
LFRKTCKYDPSQKSKLMKCILFFQKSRSPSVQFECANTLIQISNTPTTLKLATNIYVQLL
LNNSENNVKMVVLDKIQYILNIEPKYLEEQVIEITKVLNNPSNQIRKNAIDIISSLTNSR
NVSYIFPKVVKEVKKTISEENGKEFTKILLDFVEYCVFNFESVLDDVMNLINEVFLTNSG
LKQKTQDQVKRILTGIVTTYPQSRERLMSKLLERFRDISSPYIYNGVLWILGEYSSGEQV
TRSLDQILEAIGSLPITYVQQTTDDQKSEEKEAPKPTQKKYKTVILADGSYGTEVIEEKE
ARKQSVDASEQQDSQFRIILSQYSYIGSIAARTLLKLVFKIKLDAKKYNKYTSQILLVFC
SLIRLYTAKQSKKNEEYDLDSLEKIYLGVKLLTEPKKFVNEKIQWLESNENIVKHKEKLT
KRTDLEQQREEKKDSHIAKQPDDLIVIRALKGKQAEIGDLDLQDEEINQIEFKGVGEDND
FASKLNKLVQLTGYSDPIYAESFVYIHKYDIQFETLLINRTTKPLQKVQIEFFTQENDQK
RVIEKAQAVTLQPNQSAYVKTSLKFTSIDIGVIFGAINYENIAGIEQAYLITKEIDIDLI
DFVYPAEIDFNSYREMWAKYEWENRIVINPQKIEMLQFFLQFKEQFKLYMLNDEEEIKNA
TVICVNFYAKTKLGDDFLINISAESQNGSVTGTIRIRSKVKGVVVSIGQKYRQ


>TTHERM_00488350(gene)
ATGGCATCAGCAAATATATAATAAGCTAGCGAGCACAAAGAACGTTATTGTAGCATTTAT
ATTAGAGCTGAATAAGAGCAGCTCACTCCTTAAGAAATTAAGACTCTTCTTATGGGAAAA
TATGAAGAAAAGATTAAAGGTCTTAAGTCCCTCATTTATGCAATTATTCAGGATGAGAAT
TTTGATAAATTGACCATGACTATTATAACTTACTTGGTTCCTTATCAAGCTGAAAACCAT
GACCTCAAGAAGATTTTGTTGTACTACTGGGAAGTAAATAAATAAATAGATCAATAAATT
ATGAGCAATATTTATCATGAAAGCAAGCAAATATTCAAAAGCTGAATAAAAACCAGATAA
ATTAATTTATTTTAATTGATTTTGCAGTAAATAAATATAAATGAAATCATTTAGAAATAT
CTATGAATATGTTTTTGAGCTTGAAATGATGAATATTAAATAAGAAGAAGCATATTAATT
TTATTATAAAATGAATATAAAAATAGATCATTGAGAAGGTCAATAAAGATGGTAAGCTTA
AAGACGAAATGATTTTAGTTTGCAACAGTTTGAGATCAGACTTGTTGCATCCAAACGAGT
ATTTAAGAGGAAGAACTCTTCGTTTGGTTTCAAGAATTATGTATAAGGGTATTTTAGAGC
CTTTAATTTCAAGTATTATGGAAAGCTTAAATCACAAGCACACTTATGTTAGAAGAAATG
CTATTATCGCTATTTACTAAATATTTTTAAATTTCGGTGATGATCTGATTAATGATATCG
ATACTGAAATGGAAAAGGTCCTCTAAAACGAAACTGATTTGTCAACCAAAAGAAACGCTT
TCCTACTTCTTTATCATACCAACCTTGAGAAAGCTATGGCTTACCTCTATTAAATTATTT
AAGATGATAGAGTTGACGAAATGGGAGACATCATGCAACTTTCAGTCTTGGAACTCTTTA
GGTAATTTAATACTCAAAATATTTTTTGGATACAAAAAAAATGATATTGTCTACAAAAGC
AAACGATTTTCCTCAATTTAAATTTAAGACTTAAAGATTCAACCTCCTTTTATATATATA
ATTTGGAATTGGAATGTATTTAGTTAAATAGCCAACAAATTGACTGATCATTCATTCTTT
GAATAAAGCATAATGTATAGTAGCAAAGAGTTAGAAATAATGTTAAATAAATAAAATTAC
CACAAAATAAAGCAATAAAAAAGAAATGGTTTAATTATTGTAAACATATATAAATATAAA
AATACTAAAGGCAATGTTATTGATTGTGTACTTAAAAAGGAAAGACACACAAGTATTATT
TGTCAAATTTTAGGTTTTTAGATCTCATTATTTAATTAATAGTTCAATAGTTGGTTTAAA
TTCTCATCAATAATTTTCGATATTAATATTATTATATCTATTACTCATTTTAAACTCTAA
AAATAAATTCATATTCCAATTTAATATGAAACAAAAAAGCAATTAAACTTGAAATTAAAA
CCTAGATAGATTTTAAAAACAAAATATAAATTAAGCAACTTTCTTTAAGTTCCATAAGTC
AATAAAGTGCAATATTTTTAGAAACAACAAATTAAACAGTGGATGTTATGATTAACCTTT
CACCTCAAATTAAGAATATCAATAATTTTATTGATAACTAAAATAAGGAGGATTTTATTA
ATTTTACAAAATTGAGAGATACTTTCACTTATTTTAAAAATAAATATCGTCTAATAAATT
CAATAAATAAAAATTATTCTATTTTTTTCTATAAAATTAAAAATACATTTAAATATTTAT
TTAATTTGAATAGAAAAACTTGCAAATATGATCCTAGCTAGAAATCTAAGCTTATGAAAT
GCATTTTATTCTTCTAAAAATCCCGTAGTCCTTCTGTTTAGTTTGAGTGTGCTAATACTT
TAATATAAATATCTAATACACCTACAACTTTGAAGTTAGCCACTAATATATATGTTTAAC
TATTGTTAAATAACTCAGAAAACAATGTTAAAATGGTAGTTCTTGATAAAATTTAATATA
TTCTCAATATTGAACCTAAATATCTTGAAGAACAAGTTATTGAAATTACTAAAGTATTGA
ACAATCCTTCTAACTAAATTCGTAAAAATGCCATTGATATTATTTCAAGCTTAACTAACT
CTAGAAACGTCAGCTATATCTTCCCTAAGGTTGTCAAAGAAGTAAAGAAGACAATTTCTG
AAGAAAAGTAATTTTTAGCTAGATTGCCATCATATTTTTAATTATATTATTTTTATTAGT
GGAAAGGAATTTACTAAGATTCTTCTTGATTTTGTTGAGTACTGCGTTTTTAACTTTGAA
AGCGTTTTAGACGATGTTATGAATTTGATCAACGAAGTATTCTTAACTAACAGTGGCTTA
AAACAAAAAACTTAAGATCAAGTAAAAAGAATCCTTACTGGAATTGTTACAACCTATCCT
CAAAGCAGAGAGCGTTTGATGTCAAAGTTGTTAGAAAGATTTAGAGACATCTCATCTCCT
TACATATACAATGGTGTTCTCTGGATTCTTGGTGAATACTCCTCAGGAGAATAAGTCACC
CGTAGCTTAGATTAAATCTTAGAAGCAATTGGTTCACTTCCAATCACCTATGTTTAATAA
ACTACCGACGACCAAAAGTCAGAAGAAAAAGAAGCACCTAAACCTACTTAAAAAAAATAC
AAAACAGTCATTTTAGCTGATGGTAGCTATGGTACTGAAGTAATTGAAGAAAAGGAAGCA
AGAAGTAAATCTATAAATTAAATCATAATCTTATAAATTATTATAAATTTCTAATTTTTT
TAAAAATAAAAAATAAATAATTACCATAATTTTTTACAAAAAAATAGAATAATCAGTTGA
TGCTAGTGAACAACAAGATTCTTAATTCAGAATTATTCTTTCTCAATATTCTTACATAGG
TAGTATTGCTGCCCGTACTTTACTAAAGCTGGTTTTCAAGATCAAGCTTGATGCTAAGAA
ATACAACAAGTACACTAGCTAAATTTTGTTAGTTTTCTGTTCTTTGATTAGATTGTACAC
TGCTAAGCAAAGCAAGAAGGTAGAATAAATTATTGCAATATTATAAAATGTATTAAAATT
ATTCATATTTAATTTAGAATGAAGAATATGATTTAGATTCTCTTGAAAAAATATACCTTG
GTGTTAAGTTATTGACTGAGCCTAAGAAGTTTGTAAATGAAAAGATTTAATGGTTAGAAA
GCAATGAAAATATTGTGAAGCACAAAGAGAAATTGACAAAGAGAACTGATCTTGAACAAT
AAAGAGAAGAAAAGAAAGATTCACATATTGCCAAATAGCCTGATGATTTAATTGTTATTA
GAGCCTTGAAGTAAATAAAAAAATAAAATTGTAATAATTAACTTTTTAAATGTAAACTTA
AAGGGGTAAGCAAGCAGAAATTGGTGATTTAGATTTGTAGGATGAAGAAATAAATTAAAT
AGAATTTAAAGGAGTTGGAGAAGACAATGATTTTGCAAGCAAATTAAATAAATTGGTCTA
ATTAACTGGATATAGTGATCCAATTTATGCTGAATCATTTGTTTACATTCATAAATATGA
TATTTAATTCGAAACTTTGTTAATAAATCGCACAACCAAGCCCTTACAAAAAGTTCAAAT
AGAATTCTTCACTCAAGAAAATGATTAAAAGAGAGTAATTGAGAAGGCATAGGCTGTAAC
CTTATAACCTAACTAAAGTGCTTATGTAAAAACTTCTCTTAAATTCACCTCAATAGATAT
AGGAGTTATTTTCGGTGCCATCAACTACGAAAATATTGCTGGTATTGAACAAGCTTATTT
AATCACTAAAGAAATAGATATTGACCTAATTGATTTCGTATATCCTGCAGAAATAGATTT
TAATTCTTATAGAGAAATGTGGGCTAAGTATGAATGGGAAAACCGTATTGTCATCAATCC
TCAAAAGATGTAAATAATTATTTAATAATTAACCTTAATATAAAATTTAAAAAAATATTT
ATTTATATTAATTAAAACTAAAATTTATTTTAATGTCTAAAAAAGCGAGATGTTATAATT
CTTCCTCTAATTCAAAGAATAATTTAAATTATATATGCTTAACGACGAAGAGGAAATCAA
AAATGCTACAGTAATTTGTGTCAATTTCTATGCTAAGACCAAGCTAGGTAAAAAAATGAT
AAAGAAATAACTTTAAACTAAATTTAAATTATATAATATTAGGTGATGATTTCCTCATAA
ACATCAGCGCAGAGTCTCAAAATGGTTCTGTTACAGGAACAATTAGAATCAGAAGTAAAG
TTAAAGTAATTTTAATAATTTATCTAAATGAAGGTCGTTAACAATATATAATATAAAAAA
AGGGTGTAGTTGTAAGCATAGGATAAAAATATAGGTAATGA