Identifiers and Description

Gene Model Identifier

TTHERM_00460480

Standard Name

COM1 (Homolog of budding yeast COM1/SAE2)

Aliases

PreTt25699 | 54.m00155 | 3823.m01074

Description

Com1p is required for meiotic double-strand break repair and full homologous pairing

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00460480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10790.19.997093137033517e-262hypothetical protein (634 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26519827: Lukaszewicz A, Shodhan A, Loidl J (2015) Exo1 and Mre11 execute meiotic DSB end resection in the protist Tetrahymena. DNA repair 35( ):137-43
  2. Ref:20422424: Lukaszewicz A, Howard-Till RA, Novatchkova M, Mochizuki K, Loidl J (2010) MRE11 and COM1/SAE2 are required for double-strand break repair and efficient chromosome pairing during meiosis of the protist Tetrahymena. Chromosoma 119(5):505-18

Sequences

>TTHERM_00460480(coding)
ATGCTTGGGTTAGAATAAAATTGTTTTATTAAAGAATACAGGAAGTAGGTAGATAAAGAG
GCTCTAAATTAAATATAAGATGCTGCTTTATCAAATTTAATGAATGCATTTGGGTAGATG
AATTAAACATATTCTGTACTTTTCAAAGATATTTGTCTTACTTTTGGCGCTTTATTATCA
ATAAAGGAAGAGTTAAAGGACTATCGCTAGGAAATGTTTTAGAAATAAAGCGAGAAAATT
ATCTAGGAGAAGATTCAGAAGGAAATGATTCAATAAAAAGATGAGCAATTGGAATTCCTC
TAAAAGTAATTGAAAATAGTTTAACTGCAATCTGATTAAGATAGAAATTCTAAACAGGCA
ATTCAAGAGAGGGATTAGGCCATAAGTTCATATAAATAAAGACTTTTTGATTTATAAGAA
AATGAAAAGAAATTGCTCAGCGAAAAGTCTTAGCTTCAGACTAGAATTGAGTTACTTGAA
GAATAATAAAATTCTAACAAAGTTGCAATCTTAGAAAAGCAAACCACTCTTCATTAAGGT
TATAAACTCACATTTTTAAATAACGAATTAAAAGAATCTCTTATTGAACAACCTTCAAAT
GTATTTTAATAAGAAAACGGGGTTAATAAAAATAAAATATATAGCTTGGATAATAATTAG
ATATAAAAGAATAATACTTCCCTTTTAAGTAAATTTAAGTAAGACCAATCTGATTAAGAG
GTGTAAAATAATACATAACTTGCTCAAAAAAACTAATAGGATATTTATTATAGTAACAAA
ATAAATCAGATAAAACCTGAAACATTTTCAAATCAAGATCCTTCAGTTTATTTACAAGAA
AGCTATGTATAAAGTTCACTTAATGCAAATAATATTTTAGGTTCAAAAAAGATTACAGAT
GAAGAGATTTTTATGATGTAAAAAAGAGAAGCTGAAATTAAAAAAAAGAAATAGGAAGAT
GAACATTTAAAGAATTAATAATACATGTCAAGTTTGAATTACAATAAAATAATTTCTGAT
AAAAATAAAAATTAGAATTTAATGAATAATAAAATTATTGAGTAATCTAAAGAGAGTTCT
ATGGGATCTTTATTCAATAAGACAGCTTTTGATCAAAGCTCAATTAATAATCAAAGTAAT
GCTAGTGTAAGAATGGAATTAGAAGATTCTAGTGCTGGATAACAGCTTTAAAGATATAAA
GTAAGCTTAAATGATAGAAAAATGGTAGCTGAAAATAATCTAAATGCAACAGATGATTTA
TTAAAAAATAAAATGGAGCAGGAAGATAATGAAAAAGAGAGTTCTGACTCTTAGTATAAC
TGGAATTTAAAAATCGATTTGAAAAACAATAACGAATAATAGCAGCAATTTCCATAGGAA
AGCAATAACAATAGTGGAAACAAAAAGAGATTCAAAAAGTAACAATTAAAAAAATCAGAT
TCTTTTGCCACAAATGCAAACTAGAATTCTGAATTAGAAAACACCACAGCTAGTGTTATT
AGTTTACAAAACTAACAATAAAATTAAAATTATGAAATTTAAGATCAATAAAGCAATTAA
ATGCTCTTAGGTCAAAAGAAAAATTTAAATATTAATAAAGGTAGAGTTGCTAATAATAAA
TTTATGAAAGACATAGAATTAGATGATGAAAGTGGGGACAAAGACTAACCCTAATAAAAT
GATATATTTGCTCAGTTTCAATATAAAAAAAGAGGTACTTCAAACTAAGAAGTTCAAGTA
GCTGAAACTTTTAACATGTATAACAAATAAAATTAGAGACCATTAAATCCTCGTAAAAAA
GAAGATAGAGAAAAATTAAAAACTTTTAATTGTGGCAGATGCAAAGCCGCATATCAAACT
TTGGGAGAAGAATTCTGTGGTAATTGTTCTAAACACAGATCAGAATACACGCCTCCTCAC
ACTCCCGAAGCCCATTATTAAAAATTTTCCTAGTCAGAAGATGATTCTAATTGA


>TTHERM_00460480(protein)
MLGLEQNCFIKEYRKQVDKEALNQIQDAALSNLMNAFGQMNQTYSVLFKDICLTFGALLS
IKEELKDYRQEMFQKQSEKIIQEKIQKEMIQQKDEQLEFLQKQLKIVQLQSDQDRNSKQA
IQERDQAISSYKQRLFDLQENEKKLLSEKSQLQTRIELLEEQQNSNKVAILEKQTTLHQG
YKLTFLNNELKESLIEQPSNVFQQENGVNKNKIYSLDNNQIQKNNTSLLSKFKQDQSDQE
VQNNTQLAQKNQQDIYYSNKINQIKPETFSNQDPSVYLQESYVQSSLNANNILGSKKITD
EEIFMMQKREAEIKKKKQEDEHLKNQQYMSSLNYNKIISDKNKNQNLMNNKIIEQSKESS
MGSLFNKTAFDQSSINNQSNASVRMELEDSSAGQQLQRYKVSLNDRKMVAENNLNATDDL
LKNKMEQEDNEKESSDSQYNWNLKIDLKNNNEQQQQFPQESNNNSGNKKRFKKQQLKKSD
SFATNANQNSELENTTASVISLQNQQQNQNYEIQDQQSNQMLLGQKKNLNINKGRVANNK
FMKDIELDDESGDKDQPQQNDIFAQFQYKKRGTSNQEVQVAETFNMYNKQNQRPLNPRKK
EDREKLKTFNCGRCKAAYQTLGEEFCGNCSKHRSEYTPPHTPEAHYQKFSQSEDDSN


>TTHERM_00460480(gene)
ATGCTTGGGTTAGAATAAAATTGTTTTATTAAAGAATACAGGAAGTAGGTAGATAAAGAG
GCTCTAAATTAAATATAAGATGCTGCTTTATCAAATTTAATGAATGCATTTGGGTAGATG
AATTAAACATATTCTGTACTTTTCAAAGATATTTGTCTTACTTTTGGCGCTTTATTATCA
ATAAAGGAAGAGTTAAAGGACTATCGCTAGGAAATGTTTTAGAAATGTAAAATTTGAGAA
ATTTCGATTAAAGAAATGCAAAGTTATTCAAATTTTATTATCAATAGAAAGCGAGAAAAT
TATCTAGGAGAAGATTCAGAAGGAAATGATTCAATAAAAAGATGAGCAATTGGAATTCCT
CTAAAAGTAATTGAAAATAGTTTAACTGCAATCTGATTAAGATAGAAATTCTAAACAGGC
AATTCAAGAGAGGGATTAGGCCATAAGTTCATATAAATAAAGACTTTTTGATTTATAAGA
AAATGAAAAGAAATTGCTCAGCGAAAAGTCTTAGCTTCAGACTAGAATTGAGTTACTTGA
AGAATAATAAAAGTAAATAAATTTGATAATAATTTGTTATCAGAAATAAGTTTAAAAATA
TATTAAAATTTTAAGTATCCAGCTTAGATATTAAAAAATTATTCTTTTCTTTAACTAATA
TAACAGTTCTAACAAAGTTGCAATCTTAGAAAAGCAAACCACTCTTCATTAAGGTTATAA
ACTCACATTTTTAAATAACGAATTAAAAGAATCTCTTATTGAACAACCTTCAAATGTATT
TTAATAAGAAAACGGGGTTAATAAAAATAAAATATATAGCTTGGATAATAATTAGATATA
AAAGAATAATACTTCCCTTTTAAGTAAATTTAAGTAAGACCAATCTGATTAAGAGGTGTA
AAATAATACATAACTTGCTCAAAAAAACTAATAGGATATTTATTATAGTAACAAAATAAA
TCAGATAAAACCTGAAACATTTTCAAATCAAGATCCTTCAGTTTATTTACAAGAAAGCTA
TGTATAAAGTTCACTTAATGCAAATAATATTTTAGGTTCAAAAAAGATTACAGATGAAGA
GATTTTTATGATGTAAAAAAGAGAAGCTGAAATTAAAAAAAAGAAATAGGAAGATGAACA
TTTAAAGAATTAATAATACATGTCAAGTTTGAATTACAATAAAATAATTTCTGATAAAAA
TAAAAATTAGAATTTAATGAATAATAAAATTATTGAGTAATCTAAAGAGAGTTCTATGGG
ATCTTTATTCAATAAGACAGCTTTTGGTAAAACAAATTTATTTATTCTAATTGTTTAAAA
AAATTTAAATTAAATTAATAGATCAAAGCTCAATTAATAATCAAAGTAATGCTAGTGTAA
GAATGGAATTAGAAGATTCTAGTGCTGGATAACAGCTTTAAAGATATAAAGTAAGCTTAA
ATGATAGAAAAATGGTAGCTGAAAATAATCTAAATGCAACAGATGATTTATTAAAAAATA
AAATGGAGCAGGAAGATAATGAAAAAGAGAGTTCTGACTCTTAGTATAACTGGAATTTAA
AAATCGATTTGAAAAACAATAACGAATAATAGCAGCAATTTCCATAGGAAAGCAATAACA
ATAGTGGAAACAAAAAGAGATTCAAAAAGTAACAATTAAAAAAATCAGATTCTTTTGCCA
CAAATGCAAACTAGAATTCTGAATTAGAAAACACCACAGCTAGTGTTATTAGTTTACAAA
ACTAACAATAAAATTAAAATTATGAAATTTAAGATCAATAAAGCAATTAAATGCTCTTAG
GTCAAAAGAAAAATTTAAATATTAATAAAGGTAGAGTTGCTAATAATAAATTTATGAAAG
ACATAGAATTAGATGATGAAAGTGGGGACAAAGACTAACCCTAATAAAATGATATATTTG
CTCAGTTTCAATATAAAAAAAGAGGTACTTCAAACTAAGAAGTTCAAGTAGCTGAAACTT
TTAACATGTATAACAAATAAAATTAGAGACCATTAAATCCTCGTAAAAAAGAAGATAGAG
AAAAATTAAAAACTTTTAATTGTGGCAGATGCAAAGCCGCATATCAAACTTTGGGAGAAG
AATTCTGTGGTAATTGTTCTAAACACAGATCAGAATACACGCCTCCTCACACTCCCGAAG
CCCATTATTAAAAATTTTCCTAGTCAGAAGATGATTCTAATTGA