Identifiers and Description

Gene Model Identifier

TTHERM_00526270

Standard Name

COI3 (Conjugation-induced 3)

Aliases

PreTt06365 | 66.m00164 | 3722.m00022 | ATG4.1

Description

TTHERM_00526270 consists of two genes: COI3 and a gene encoding peptidase family C54 containing protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 23.6%

TetraMine Data

TTHERM_00526270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13377.19.997093137033517e-262peptidase family C54 containin
g protein (1106 aa)
OxytrichaContig22038.0.g1069.000751454575209e-33Peptidase family C54
WormBaseWBGene000135955.0000961330688895e-23locus:atg-4.1 status:Confirm
ed UniProt:Q9NA30 protein_
id:CAB54483.2
DictyBaseDDB_G02837530.0000000000000030004923591262316DDB_G0283753 on chromosome: 4
position 1050017 to 1052135
Stentor CoeruleusSteCoe_350960.000000000000012664165549094176
SGDYNL223W0.0000000006000548789370351ATG4 Conserved cysteine protea
se required for autophagy; cle
aves Atg8p to a form required
for autophagosome and Cvt vesi
cle generation

General Information

Paragraph NoGene NameParagraph Text
111JUB1,
JUB2,
JUB3,
JUB4,
HPL2,
COI3,
COI6,
COI16,
JUB6
This protein co-localizes with Pdd1p in heterochromatin body in the new macronucleus.

Associated Literature

  1. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77
  2. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  3. Ref:22366125: Liu ML, Yao MC (2012) Role of ATG8 and autophagy in programmed nuclear degradation in Tetrahymena thermophila. Eukaryotic cell 11(4):494-506

Sequences

>TTHERM_00526270(coding)
ATGGTCTTAATTGCAGTATCTTATTTGCTTTGCAGAAGTACTCAAATTTATAGATAGTTA
TTAGAATTTAGAGATATATATATACTTTGTAAAACTTGGATTATTTATAAAATCTAATTT
AATAAATCTACTAATTCAGTCGCATTAGCAAATATTTTAGAGATGTCTTAGTCTAAAGAA
ATTGATTATTTCAAATCCATAAAGCTATCAATGTCCAAAGCTTTTTCTGAAGATGGAAGA
CGTGTTTCTACTAATAATATTACTGAAGGTATTATGAGCTACGGGATGTAGCAGATATAC
AGATTTAATAAATGGGGAACTTCATGTAAAACAATAGATCTTAAGGTTGATATCCCATCT
TTCATATTAGGAAATGATTTAACACCGCAAAGAGTAAAGTTAGTTTAGGATAAAAGTAGA
GTTTTACAAGATGATGGCAATTAGAATAAATACAGAATGCTTATGTTGTCTAATTCAAGT
GATATTAGAGTAGACACAGAACCAAAATAAGAAGAAATAATATCTAAAGAAACATACTAA
ACATAAGAGACTTCTGGATAAGACTATGATGATGAAGATTATCAAGAAACAGAAAAATAA
ATGAAAGAAAAATCAAAATAAATACTTTAAATTTACTAAAACACAATCCTTTTTACATAT
AGAAAAAACTTCTATCCTTTACTAAAAGACAAAATAAATGACCCACAAAAGAATTAAACT
TCAGATGCGGGATGGGGCTGTATGATTCGAGCTGGATAAATGATTTTTGCTTAGACTATA
AAGAGACATTTAAAAAAAACAGACTATATAGAATAGCATTAGCTAATAAACATTATAATA
GGCTTTTTAGAAGAAGAGGAAGTACAAGAAGGAGGAAAAGGATATATTTTTAATTAATAA
AGTTATATATAAGATAGAATTCGTCCTTATAGCATACATCAAATTACTAATAGAGCATTT
TGTAAATATAAAATACAACCAGGGTAATGGTACACTCCAAATTAAATCGCCATCATATTA
AAGGAGCTCCATAAAAAAAATAAAATTAAAGGAACTGAAAATTTAAAAATAGATGTTCAT
AGTAGTGATAAACCAATTATATTTGAAAAAATCTTGTAAACACTTTTGGGGCGTTAAGGC
AAAATTAATTTAAACTGCAACCATGAAAATTAGTAATCAAGAAACTCAATAAATCAAGAT
TAAGATGATTCGTTTGAAAAAATCATGCCTCCTAACTAGCAAGAAATAGAAGAGTTTTCA
AGCTAGTATGAAGAAAGCAAGGAAGATTAGACAGATAATTTATGTTGTAAAGACTGCTTT
AAAACAGACAACAAGCTGTTTCTCCTTCTACCATGCAGACTAGGATTAGATGAAATCAGC
CCAATTCATATAGAAATCCTTAAAAAATTATTGTCTCTCAAACAATCTGTTGGAATGATA
GGAGGTAAACCAAACAAAGCTCACTACTTTTTAGGATTTGTAGGAGATGATTTATTATAT
TTAGATCCTCATTATATCAAAGAATGTGTTAGAAAAGAAGATCTAATGGAAAATATTTCT
TCTTATTTCGAAGAAGATGTTTTTAAAATGCCAATAAATAAAATTAGTACCTCATTGGTG
TTTGGATTTTATTTTAGTGGCGTTGATGAGCTAAATAAATTCTATAAATTTTTAAGATAA
CTAGAAAAAGAATATAAAGATGATTTTTTCCTTGTAATTGAAAAATAAACTCCTTCTTAT
GCAATGTCGAATATCTCTGAGATAAAAAAGTTGACTAAGTAAATAAAGATTACTTAAAAA
GATAATTAAAATCTTTTGGAATAATAATTTGAGAATTATGATGGATCAGTAGGTGATGAC
TTTGATGAAGATGATGATACAAGCTATGATGAATAAGAATGCTATGAAGACAAATTAGAT
GAATTCGATTAATATAATAACTTAGAAGAATCAGACTATTCTTAAAAGCTTAAACAATAA
ACTAATTTAAAAAACTACAGTGACCCATTTGGTACTGAAAGCCATTCCGAAAACCAATTA
AAATATGGAAAATTGGCTAATCATGAGCTACCAATAAGAAACCAGATCTAAAAAAAATAA
AGTGAAGAGGAATTAAAAAATCTTGTAAATTTAATTTAATTATAGTAACAAAATCAGCAG
ATAAGTAACTTATTATAAAATCAGAATTGTATTTGA


>TTHERM_00526270(protein)
MVLIAVSYLLCRSTQIYRQLLEFRDIYILCKTWIIYKIQFNKSTNSVALANILEMSQSKE
IDYFKSIKLSMSKAFSEDGRRVSTNNITEGIMSYGMQQIYRFNKWGTSCKTIDLKVDIPS
FILGNDLTPQRVKLVQDKSRVLQDDGNQNKYRMLMLSNSSDIRVDTEPKQEEIISKETYQ
TQETSGQDYDDEDYQETEKQMKEKSKQILQIYQNTILFTYRKNFYPLLKDKINDPQKNQT
SDAGWGCMIRAGQMIFAQTIKRHLKKTDYIEQHQLINIIIGFLEEEEVQEGGKGYIFNQQ
SYIQDRIRPYSIHQITNRAFCKYKIQPGQWYTPNQIAIILKELHKKNKIKGTENLKIDVH
SSDKPIIFEKILQTLLGRQGKINLNCNHENQQSRNSINQDQDDSFEKIMPPNQQEIEEFS
SQYEESKEDQTDNLCCKDCFKTDNKLFLLLPCRLGLDEISPIHIEILKKLLSLKQSVGMI
GGKPNKAHYFLGFVGDDLLYLDPHYIKECVRKEDLMENISSYFEEDVFKMPINKISTSLV
FGFYFSGVDELNKFYKFLRQLEKEYKDDFFLVIEKQTPSYAMSNISEIKKLTKQIKITQK
DNQNLLEQQFENYDGSVGDDFDEDDDTSYDEQECYEDKLDEFDQYNNLEESDYSQKLKQQ
TNLKNYSDPFGTESHSENQLKYGKLANHELPIRNQIQKKQSEEELKNLVNLIQLQQQNQQ
ISNLLQNQNCI


>TTHERM_00526270(gene)
ATGGTCTTAATTGCAGTATCTTATTTGCTTTGCAGGTAAAGTAAATTAACACACTTTGTT
TATTTATTTATAAGTATAAATTATTAGAAGTACTCAAATTTATAGATAGTTATTAGAATT
TAGAGATATATATATACTTTGTAAAACTTGGATTATTTATAAAATCTAATTTAATAAATC
TACTAATTCAGTCGCATTAGCAAATATTTTAGAGATGTCTTAGTCTAAAGAAATTGATTA
TTTCAAATCCATAAAGCTATCGTAAAAATTTTGAAATTTATTTTTACACTATTCAATCTC
CAAATCATTATTCAATTAAAATCATATTTTTTTCTATCTATCTTTATTTTTAGAATGTCC
AAAGCTTTTTCTGAAGATGGAAGACGTGTTTCTACTAATAATATTACTGAAGGTATTATG
AGCTACGGGTAATCCATAAATCATTATATTAAACAGCCATATTTTATATTTATATCACTT
AATAGAAAAGCATTATATGAATTCAATTTTTAAAAACATTTATTAGGATGTAGCAGATAT
ACAGATTTAATAAATGGGGAACTTCATGTAAAACAATAGATCTTAAGGTTGATATCCCAT
CTTTCATATTAGGAAATGATTTAACACCGCAAAGAGTAAAGTTAGTTTAGGATAAAAGTA
GAGTTTTACAAGATGATGGCAATTAGAATAAATACAGAATGCTTATGTTGTCTAATTCAA
GTGATATTAGAGTAGACACAGAACCAAAATAAGAAGAAATAATATCTAAAGAAACATACT
AAACATAAGAGACTTCTGGATAAGACTATGATGATGAAGATTATCAAGAAACAGAAAAAT
AAATGAAAGAAAAATCAAAATAAATACTTTAAATTTACTAAAACACAATCCTTTTTACAT
ATAGAAAAAACTTCTATCCTTTACTAAAAGACAAAATAAATGACCCACAAAAGAATTAAA
CTTCAGATGCGGGATGGGGCTGTATGATTCGAGCTGGATAAATGATTTTTGCTTAGACTA
TAAAGAGACATTTAAAAAAAACAGACTATATAGAATAGCATTAGCTAATAAACATTATAA
TAGGTTAAATACATTAATTATTATTATTATTATCTAAAAAACTAATTTGATACATCAAAA
ATTTAGGCTTTTTAGAAGAAGAGGAAGTACAAGAAGGAGGAAAAGGATATATTTTTAATT
AATAAAGTTATATATAAGATAGAATTCGTCCTTATAGCATACATCAAATTACTAATAGAG
CATTTTGTAAATATAAAATACAACCAGGGTAATGGTACACTCCAAATTAAATCGCCATCA
TATTAAAGGAGCTCCATAAAAAAAATAAAATTAAAGGAACTGAAAATTTAAAAATAGATG
TTCATAGTAGTGATAAACCAATTATATTTGAAAAAATCTTGTAAACACTTTTGGGGCGTT
AAGGCAAAATTAATTTAAACTGCAACCATGAAAATTAGTAATCAAGAAACTCAATAAATC
AAGATTAAGATGAGTAAAATATTAAAGCCAATATTTAGAGTGCTAAAATATTCTAATTAA
TTTATAAAAAATATTAATTAGAATATTTTAATTTGATAAAAATCAATATATTGATTTAAT
TTTATTATTAATTAACAGTTCGTTTGAAAAAATCATGCCTCCTAACTAGCAAGAAATGTA
AATAAATAAATATTTTATATTATCAAGTTAAATAAAATGTTTTGTATACAATAAAGAGAA
GAGTTTTCAAGCTAGTATGAAGAAAGCAAGGAAGATTAGACAGATAATTTATGTTGTAAA
GACTGCTTTAAAACAGACAACAAGCTGTTTCTCCTTCTACCATGCAGACTAGGATTAGAT
GAAATCAGCCCAATTCATATAGAAATCCTTAAAAAATTATTGTCTCTCAAACAATCTGTT
GGAATGATAGGTAAGAAAATAAATTGCATTTATTGGATATAAATTATTTTATTAAATATA
CTTGATAATTTAATAGAATTTTAATAAAAATTTTTGAATTTACTTTTCCAAAAACCATTT
TAAATAAAGATTATTTATTTGAAAAAATATTTTTAAATTTTTCTAAATGTAAAAAATAAG
GTTTATGATTATATTAACTCATTTTTTTAATTTCTTAATTAATTAAGGAGGTAAACCAAA
CAAAGCTCACTACTTTTTAGGATTTGTAGGAGATGATTTATTATATTTAGATCCTCATTA
TATCAAAGAATGTGTTAGAAAAGAAGATCTAATGGAAAATATTTCTTCTTATTTCGAAGA
AGATGTTTTTAAAATGCCAATAAATAAAATTAGTACCTCATTGGTGTTTGGATTTTATTT
TAGTGGCGTTGATGAGCTAAATAAATTCTATAAATTTTTAAGATAACTAGAAAAAGAATA
TAAAGATGATTTTTTCCTTGTAATTGAAAAATAAACTCCTTCTTATGCAATGTCGAATAT
CTCTGAGATAAAAAAGTTGACTAAGTAAATAAAGATTACTTAAAAAGATAATTAAAATCT
TTTGGAATAATAATTTGAGAATTATGATGGATCAGTAGGTGATGACTTTGATGAAGATGA
TGATACAAGCTATGATGAATAAGAATGCTATGAAGACAAATTAGATGAATTCGATTAATA
TAATAACTTAGAAGAATCAGACTATTCTTAAAAGCTTAAACAATAAACTAATTTAAAAAA
CTACAGTGACCCATTTGGTACTGAAAGCCATTCCGAAAACCAATTAAAATATGGAAAATT
GGCTAATCATGAGCTACCAATAAGAAACCAGATCTAAAAAAAATAAAGTGAAGAGGAATT
AAAAAATCTTGTAAATTTAATTTAATTATAGTAACAAAATCAGCAGATAAGTAACTTATT
ATAAAATCAGAATTGTATTTGA