Identifiers and Description

Gene Model Identifier

TTHERM_00193969

Standard Name

COI21 (Conjugation-induced 21)

Aliases

16.m05350

Description

conserved hypothetical protein specifically expressed during conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00193969

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03673.18.002321170708988e-179hypothetical protein (382 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  2. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77

Sequences

>TTHERM_00193969(protein)
MNQISDLKNQLQKLIAKRQDLQHQIFNLQIQSESFNQKQQQIEQELIKMTKAQTLNEIHN
SFSVSKNDRSSDQVQHSFVSTKPSTSFMQNNDGSSILSSLKLSNQQYFNQQKEGLNLSQI
SQSLNQTSLSQLNKKDLQQINNPQDDVSFLNQQLINSDEDERFEQMDDESQNGNLNELMY
NPADKSSNILNSKNQKYLETLKMFQLEGKGQKHTEQVLNKMIENWVPKNQYKTYHTLSNG
KVIDHSHIKSIPKAVVRLSDEVTGNKKQIVHDFRGLEILGTDDPETVVKKKYIKQRYEQF
IKMFKQIQPKYIQESGYCKYTDGIRKMFVFFTQIMSRNKINRDSGVKPDTLKAWAKKYGY
VDESILEVKDLDQEI


>TTHERM_00193969(coding)
ATGAATCAAATTTCAGATCTCAAGAATTAACTGTAAAAGCTTATTGCAAAGAGGCAAGAT
CTTTAGCACTAAATATTTAATTTACAGATACAATCAGAATCCTTTAATCAGAAACAGCAG
TAGATAGAATAAGAATTAATTAAAATGACCAAGGCTTAAACTTTAAATGAAATTCACAAT
AGCTTCTCTGTTTCCAAAAATGATAGATCATCTGATCAAGTTTAACATTCCTTCGTTTCT
ACTAAACCTAGTACTTCTTTTATGTAAAATAATGATGGAAGCAGTATACTATCATCTTTA
AAATTATCAAACTAATAGTATTTCAATTAGTAAAAGGAAGGTCTTAATTTAAGTTAAATT
TCCCAAAGTTTAAACTAAACTTCTCTTTCTTAGCTAAATAAAAAAGATTTGTAATAAATC
AATAACCCTCAAGATGATGTGTCTTTTTTAAACTAACAGCTAATAAATAGTGATGAAGAC
GAAAGATTTGAGCAGATGGATGATGAGTCATAAAATGGCAACCTTAATGAACTTATGTAT
AATCCAGCAGATAAATCTTCTAATATTCTTAATTCAAAAAATTAAAAATACTTAGAAACA
CTTAAAATGTTTTAATTGGAAGGTAAAGGATAAAAGCACACTGAGTAAGTCCTTAATAAA
ATGATTGAGAATTGGGTTCCAAAGAATTAATATAAAACTTATCACACTCTAAGTAATGGA
AAGGTAATAGATCATTCTCATATCAAGTCAATCCCTAAGGCTGTTGTGCGTCTGAGCGAT
GAAGTAACTGGAAATAAAAAATAAATAGTGCATGATTTTAGAGGCTTAGAAATTTTGGGC
ACAGATGATCCTGAAACAGTGGTAAAGAAGAAATATATCAAACAGAGATATGAGTAATTC
ATCAAAATGTTTAAATAAATTTAACCTAAATACATTTAAGAGAGTGGATATTGTAAATAT
ACTGATGGCATTAGAAAAATGTTTGTTTTCTTTACTCAAATTATGTCAAGAAATAAAATT
AACCGTGATAGTGGTGTCAAACCAGATACTCTGAAAGCATGGGCTAAAAAGTACGGTTAT
GTAGATGAGTCAATCTTAGAAGTGAAAGACTTAGATTAGGAAATTTGA


>TTHERM_00193969(gene)
TTTATATAATGCAATCTTCTCAAAAATGAATTATAATAATTTTAATACAAAAAAACATAT
AAATTTCAGAAAATAAAAAAATTAAAGAAAGAAATGAATCAAATTTCAGATCTCAAGAAT
TAACTGTAAAAGCTTATTGCAAAGAGGCAAGATCTTTAGCACTAAATATTTAATTTACAG
ATACAATCAGAATCCTTTAATCAGAAACAGCAGTAGATAGAATAAGAATTAATTAAAATG
ACCAAGGCTTAAACTTTAAATGAAATTCACAATAGCTTCTCTGTTTCCAAAAATGATAGA
TCATCTGATCAAGTTTAACATTCCTTCGTTTCTACTAAACCTAGTACTTCTTTTATGTAA
AATAATGATGGAAGCAGTATACTATCATCTTTAAAATTATCAAACTAATAGTATTTCAAT
TAGTAAAAGGAAGGTCTTAATTTAAGTTAAATTTCCCAAAGTTTAAACTAAACTTCTCTT
TCTTAGCTAAATAAAAAAGATTTGTAATAAATCAATAACCCTCAAGATGATGTGTCTTTT
TTAAACTAACAGCTAATAAATAGTGATGAAGACGAAAGATTTGAGCAGATGGATGATGAG
TCATAAAATGGCAACCTTAATGAACTTATGTATAATCCAGCAGATAAATCTTCTAATATT
CTTAATTCAAAAAATTAAAAATACTTAGAAACACTTAAAATGTTTTAATTGGAAGGTAAA
GGATAAAAGCACACTGAGTAAGTCCTTAATAAAATGATTGAGAATTGGGTTCCAAAGAAT
TAATATAAAACTTATCACACTCTAAGTAATGGAAAGGTAATAGATCATTCTCATATCAAG
TCAATCCCTAAGGCTGTTGTGCGTCTGAGCGATGAAGTAACTGGAAATAAAAAATAAATA
GTGCATGATTTTAGAGGCTTAGAAATTTTGGGCACAGATGATCCTGAAACAGTGGTAAAG
AAGAAATATATCAAACAGAGATATGAGTAATTCATCAAAATGTTTAAATAAATTTAACCT
AAATACATTTAAGAGAGTGGATATTGTAAATATACTGATGGCATTAGAAAAATGTTTGTT
TTCTTTACTCAAATTATGTCAAGAAATAAAATTAACCGTGATAGTGGTGTCAAACCAGAT
ACTCTGAAAGCATGGGCTAAAAAGTACGGTTATGTAGATGAGTCAATCTTAGAAGTGAAA
GACTTAGATTAGGAAATTTGA