Identifiers and Description

Gene Model Identifier

TTHERM_00046930

Standard Name

COI2 (COnjugation-Induced 2)

Aliases

PreTt11172 | 3.m02016 | 3824.m02933

Description

hypothetical protein; Specifically expressed during conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00046930

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01761.16.999281070199524e-80hypothetical protein (302 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77

Sequences

>TTHERM_00046930(coding)
ATGGACGGACAATAAAATTAAAATTAATCATAATATTTGATGGAAACGGATAGAAAGAGA
TAATATTTGACTTAAGACATATATGATCAAAATCAAGATACAGCACCAATCAATAGAAAA
AAAAATATTCAAAACTAAAAAGGATATTTAGGTGAAATAGCCTTTTCATCAAAAATTGGT
GACAAAAATTTTAGATTATATAAAGACAGTTCTCTAGGATTTGGTTAGAAAGGTTAAAAC
ATCTTAATAGATTAAGACTGGGATGAAGACATTGAGACAGACAACAGTTGTGCTGAAAAA
GCTGTTTAAAAGTGCATCAAACAACTATACTAAGCCTTGAGACATCAAAGAAGAGGAATA
GATCCCACAAGTCCTTTTGTCCATGACTACACTACATTAGGTGAGAGATATTTTAAGGAA
AATTAGTTGATTAATTAAGATAGAAATGGGATAAACTAAAATTGTAATTAAGACAGAAAT
TTAAAGATTAGCGACTCTCCTTTAATTCAGTCTAAAAGTTAAATTATGATTTAAATGTAA
GGAATGATGAACCAAATAGACATATAGCAGAGTTATCTGTCGCAACAATAATAGATAAAT
CATGATATTTTGGGTTAAGAAACTAAAAGAGATTTTATGAATACTCCTATTAGAACCAAA
GCAAGTTTTGCTCGTTAAAGCGATTCTGGATACAATTAATCTTTGAATTAGAATTATTCC
TAAAATTTATGA


>TTHERM_00046930(protein)
MDGQQNQNQSQYLMETDRKRQYLTQDIYDQNQDTAPINRKKNIQNQKGYLGEIAFSSKIG
DKNFRLYKDSSLGFGQKGQNILIDQDWDEDIETDNSCAEKAVQKCIKQLYQALRHQRRGI
DPTSPFVHDYTTLGERYFKENQLINQDRNGINQNCNQDRNLKISDSPLIQSKSQIMIQMQ
GMMNQIDIQQSYLSQQQQINHDILGQETKRDFMNTPIRTKASFARQSDSGYNQSLNQNYS
QNL


>TTHERM_00046930(gene)
ATGGACGGACAATAAAATTAAAATTAATCATAATATTTGATGGAAACGGATAGAAAGAGA
TAATATTTGACTTAAGACATATATGATCAAAATCAAGATACAGCACCAATCAATAGAAAA
AAAAATATTCAAAACTAAAAAGGTAATATTGAAATGCTAAGATATTTATTTTTTCATACT
TTAAAGCATAATTGAAAGCAATAGAATAATTTTTATTCTTAATAAATATTCTTATTTAAC
TTTTTTTTTTTAGTTTATTCTAGTTTTTGCAATATATATTTTAACATAAAATATTTTAAA
TTTGTAGGATATTTAGGTGAAATAGCCTTTTCATCAAAAATTGGTGACAAAAATTTTAGA
TTATATAAAGACAGTTCTCTAGGATTTGGTTAGAAAGGTTAAAACATCTTAATAGATTAA
GTATTTACTGATTTATTAAATTATTAATTTATCAGCTCAAATCATTTTGTTTGTTAAAAC
TTTTTCTTATTTCTACTTTTAAAATTAATTTGTTAATGCTAGGACTGGGATGAAGACATT
GAGACAGACAACAGTTGTGCTGAAAAAGCTGTTTAAAAGTGCATCAAACAACTATACTAA
GCCTTGAGACATCAAAGAAGAGGAATAGATCCCACAAGTCCTTTTGTCCATGACTACACT
ACATTAGGTGAGAGATATTTTAAGGAAAATTAGTTGATTAATTAAGATAGAAATGGGATA
AAGTAAAAATGATTTTAAGTTTACTCAAATAACAAATTTTTTAATATAGCTAAAATTGTA
ATTAAGACAGAAATTTAAAGATTAGCGACTCTCCTTTAATTCAGTCTAAAAGTTAAATTA
TGATTTAAATGTAAGGAATGATGAACCAAATAGACATATAGCAGAGTTATCTGTCGCAAC
AATAATAGATAAATCATGATATTTTGGGTTAAGAAACTAAAAGAGATTTTATGAATACTC
CTATTAGAACCAAAGCAAGTTTTGCTCGTTAAAGCGATTCTGGATACAATTAATCTTTGA
ATTAGAATTATTCCTAAAATTTATGA