Identifiers and Description

Gene Model Identifier

TTHERM_01085480

Standard Name

COI19 (COnjugation-Induced 19)

Aliases

PreTt03584 | 226.m00036 | 3799.m00184

Description

Major surface trophozoite antigen 11; Specifically expressed during conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_01085480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  2. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77

Sequences

>TTHERM_01085480(coding)
ATGATAAATACAAATTATAGCAAAAAACAAATTAAATGGAATGAAAAATAAAATGAAAAA
TTGTAAAATCTCTAACTAAATTATGCTCCTTTCGAATATATTTAGGAAGAGCTTGAATCA
GACAAAAAAATCATAGAAAATCAAATATATTTGCCTTCATAGGTTAAATAAAACGAAGAA
GATTCTATGAACGAAAATATAAACTTATAATATTTTAGAGATATTTCTAAGGATAAGGAA
TTTTCTCAGAACATTTACCTCACAAATTATTGGGAATTTAATTAAGCAAAATTAGAGGAC
CTACGTACATCTGAGATCTAGAAATAATTTGATATGCTTAGAAACGGAGACGAGCTTGAG
CCTCTTAGAGAAATATATCTTACAGACTTTGAGATAAGTATTGCACTCACTGTTCTCTCA
AACTGCCTAACAGATGGTATTATTGAGTATCTCAGAAGGATTTATGACCCTGAAAAAGAT
TATTCGTACTTGACAGACTCCTAGAAAACAATAATTAACAAATTTGTTCAATATTTACCT
TAATACAGTATTGTCTTGCTTAACCAATAAATGCCTTTTGATAAAAAATAGTTTATTGAA
ACTCACTACATCACCTATAAAGTTAAAATATCAAAATAGATTCATAAGGATAATCATTTG
CTCTGCGATGTCTTCCTCAGATACGAAAAATTTTCGGAATATGAAATCTCACTTAGATAT
TTCATGTAAAAAAAATTAGAAGTACTTATTGATTAAAAATTCAATTCAACCAAAGAACTT
ATCAAAGCTCTTTAGCTTATGTATAATGAAGAGAAGAACAAAATTTAAACAATAGCTGAA
AACTCTTCTGTTACCCTCTCAACTTGTATTCATACTTAGTAAAAGATATAGCCCAACGAA
GAATCTTTTAATACAAAACTTGATTATTCGTAGACTGATAATGAATCTCCTTTAAAAAAA
GATTAGCTATAAAGTAAGATATTACCTAATTACATAATAATTAAAGAAGAAAAAGCTGAT
AAAGTAAATTAAGAGTAAAAAAAATAAAGCAATTTAATTAATGGAAACTTCACTTAAAAA
AATAAAGAAAATTCAGGTAAAATGAATCTTTAAAAGTAAGATAATGTACAAAAAGATTTA
TTCTAGCAAAAGCATTCTAAAGATTTAAATATTTTATGCAATTAAAATAAGAAAAAAGGT
GTAAACGTACTACAACTCAATCTAGATGAAAAGTAAAAATTAATTTAAGATAAGATTCAA
TTTATCGAGTTTATAATCTCCAAGGTTCCTGTTGTAAAATAAAAATTTCATATTTCTAAA
AATGAGAAATCAATTTAATAAGTTCTTTAGGCATATAAAAGTATAAATAGCATTATTGAA
AAAGCAAGAGAACTCAATCAAAAGGTTAATATACAATAGATTAACACATTTTTAACAGCT
TATAAGTCTAAAAAGATAGATAACATCTTAAATGAAATTAAGAGATCAAACAAAAAATAC
TTTGTGTGA


>TTHERM_01085480(protein)
MINTNYSKKQIKWNEKQNEKLQNLQLNYAPFEYIQEELESDKKIIENQIYLPSQVKQNEE
DSMNENINLQYFRDISKDKEFSQNIYLTNYWEFNQAKLEDLRTSEIQKQFDMLRNGDELE
PLREIYLTDFEISIALTVLSNCLTDGIIEYLRRIYDPEKDYSYLTDSQKTIINKFVQYLP
QYSIVLLNQQMPFDKKQFIETHYITYKVKISKQIHKDNHLLCDVFLRYEKFSEYEISLRY
FMQKKLEVLIDQKFNSTKELIKALQLMYNEEKNKIQTIAENSSVTLSTCIHTQQKIQPNE
ESFNTKLDYSQTDNESPLKKDQLQSKILPNYIIIKEEKADKVNQEQKKQSNLINGNFTQK
NKENSGKMNLQKQDNVQKDLFQQKHSKDLNILCNQNKKKGVNVLQLNLDEKQKLIQDKIQ
FIEFIISKVPVVKQKFHISKNEKSIQQVLQAYKSINSIIEKARELNQKVNIQQINTFLTA
YKSKKIDNILNEIKRSNKKYFV


>TTHERM_01085480(gene)
ATGATAAATACAAATTATAGCAAAAAACAAATTAAATGGAATGAAAAATAAAATGAAAAA
TTGTAAAATCTCTAACTAAATTATGCTCCTTTCGAATATATTTAGGAAGAGGTAAATTTT
ACGTTTATCTTTTTATTTTTTTGATTGCTATTTTTTAATTTATTAATTACAAGCTCTGAC
TTTACCATTTAAATATTAAATTTAATGGGAACTGAACCTTGTTTTTAATAGAAATATTAA
AGCTTAATATGAATTACAATAAAAATATAACCTATTTTATCAATCTAACTTTAATATTTA
AAAAATAATAACAAACAAATATATTTTCGAATTTTTTATGATTAATTTCACCTCGTTTCT
TAGAAAAACCTAGTCTAACCTATACAGATAAGTAAAATTTCTGTATATTAGATGTAATTA
AGTATAATAGAAATTATATTTACTACACTTCACTCTAGTATCAAAGAAGAAATATATACA
TATATCGTATAGTCAGTTCATCTCAATTTTTAAACTCACCCCATAAATATTTTTAAATTA
ATACAAATAATAATATTGAATTTATTTTATATGTTAAATAGCTTGAATCAGACAAAAAAA
TCATAGAAAATCAAATATATTTGCCTTCATAGGTTAAATAAAACGAAGAAGATTCTATGA
ACGAAAATATAAACTTATAATATTTTAGAGATATTTCTAAGGATAAGGAATTTTCTCAGA
ACATTTACCTCACAAATTATTGGGAATTTAATTAAGCAAAATTAGAGGACCTACGTACAT
CTGAGATCTAGAAATAATTTGATATGCTTAGAAACGGAGACGAGCTTGAGCCTCTTAGAG
AAATATATCTTACAGACTTTGAGATAAGTATTGCACTCACTGTTCTCTCAAACTGCCTAA
CAGATGGTATTATTGAGTATCTCAGAAGGATTTATGACCCTGAAAAAGATTATTCGTACT
TGACAGACTCCTAGAAAACAATAATTAACAAATTTGTTCAATATTTACCTTAATACAGTA
TTGTCTTGCTTAACCAATAAATGCCTTTTGATAAAAAATAGTTTATTGAAACTCACTACA
TCACCTATAAAGTTAAAATATCAAAATAGATTCATAAGGATAATCATTTGCTCTGCGATG
TCTTCCTCAGATACGAAAAATTTTCGGAATATGAAATCTCACTTAGATATTTCATGTAAA
AAAAATTAGAAGTACTTATTGATTAAAAATTCAATTCAACCAAAGAACTTATCAAAGCTC
TTTAGCTTATGTATAATGAAGAGAAGAACAAAATTTAAACAATAGCTGAAAACTCTTCTG
TTACCCTCTCAACTTGTATTCATACTTAGTAAAAGATATAGCCCAACGAAGAATCTTTTA
ATACAAAACTTGATTATTCGTAGACTGATAATGAATCTCCTTTAAAAAAAGATTAGCTAT
AAAGTAAGATATTACCTAATTACATAATAATTAAAGAAGAAAAAGCTGATAAAGTAAATT
AAGAGTAAAAAAAATAAAGCAATTTAATTAATGGAAACTTCACTTAAAAAAATAAAGAAA
ATTCAGGTAAAATGAATCTTTAAAAGTAAGATAATGTACAAAAAGATTTATTCTAGCAAA
AGCATTCTAAAGATTTAAATATTTTATGCAATTAAAATAAGAAAAAAGGTGTAAACGTAC
TACAACTCAATCTAGATGAAAAGTAAAAATTAATTTAAGATAAGATTCAATTTATCGAGT
TTATAATCTCCAAGGTTCCTGTTGTAAAATAAAAATTTCATATTTCTAAAAATGAGAAAT
CAATTTAATAAGTTCTTTAGGCATATAAAAGTATAAATAGCATTATTGAAAAAGCAAGAG
AACTCAATCAAAAGGTTAATATACAATAGATTAACACATTTTTAACAGCTTATAAGTCTA
AAAAGATAGATAACATCTTAAATGAAATTAAGAGATCAAACAAAAAATACTTTGTGTGA