Identifiers and Description

Gene Model Identifier

TTHERM_00197670

Standard Name

COI18 (Conjugation-induced 18)

Aliases

PreTt13635 | 17.m00242

Description

a gene specifically expressed during conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00197670

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77

Sequences

>TTHERM_00197670(coding)
ATGAATGTCTTAAATAGTAATAACTAAAATGCTAAATTTTAAAGTTATCCAGAGCAGCCA
TCTAGTGATTTAGAAACTCTCTTATAATAAAAATTGAACCAATAAGAATAATTAAAAATG
AAACCTGAAGGTGAAGATCTTTTTTTAAAAAGTGTTCATTATTAATTAGCAGGTTTAAAA
TCTAAAAATTAAACACAAATTTCTAATAATGAGTCTTTAAGTTTTTAAATAGGTCTTAAG
TTAGAGAATAAGGAAATTATTAAAAGTGCTTATAAAGATGAGTCTAAAATAAATTCAAGA
GATTAAAATCTAAGCAAATAATAAAATCAAGGAATTCTTAACTAAGGAAAGCTAATAAAT
ATAAGCTAAGTTAACTAAAATAATTTGTTACATTTTGATGATTAAAATGAATTTAGTCTA
TTTTAGGGATAAAATTCAAATAAATTTGAAGATATTTTAGCAACAAAATAATCCTAATTA
AAAAAATAAAAACTCTAAGTTAAAGAAATTACAAACAATTTAAATGTAAGAGATCATAGT
TTAAATAAAACTAGAGTGAATAATCTTAAATAATAAGAAAAGAAGGTTTACAAATGA


>TTHERM_00197670(protein)
MNVLNSNNQNAKFQSYPEQPSSDLETLLQQKLNQQEQLKMKPEGEDLFLKSVHYQLAGLK
SKNQTQISNNESLSFQIGLKLENKEIIKSAYKDESKINSRDQNLSKQQNQGILNQGKLIN
ISQVNQNNLLHFDDQNEFSLFQGQNSNKFEDILATKQSQLKKQKLQVKEITNNLNVRDHS
LNKTRVNNLKQQEKKVYK


>TTHERM_00197670(gene)
ATGAATGTCTTAAATAGTAATAACTAAAATGCTAAATTTTAAAGTTATCCAGAGCAGCCA
TCTAGTGATTTAGAAACTCTCTTATAATAAAAATTGAACCAATAAGAATAATTAAAAATG
AAACCTGAAGGTGAAGATCTTTTTTTAAAAAGTGTTCATTATTAATTAGCAGGTTTAAAA
TCTAAAAATTAAACACAAATTTCTAATAATGAGTCTTTAAGTTTTTAAATAGGTCTTAAG
TTAGAGAATAAGGAAATTATTAAAAGTGCTTATAAAGATGAGTCTAAAATAAATTCAAGA
GATTAAAATCTAAGCAAATAATAAAATCAAGGAATTCTTAACTAAGGAAAGCTAATAAAT
ATAAGCTAAGTTAACTAAAATAATTTGTTACATTTTGATGATTAAAATGAATTTAGTCTA
TTTTAGGGATAAAATTCAAATAAATTTGAAGATATTTTAGCAACAAAATAATCCTAATTA
AAAAAATAAAAACTCTAAGTTAAAGAAATTACAAACAATTTAAATGTAAGAGATCATAGT
TTAAATAAAACTAGAGTGAATAATCTTAAATAATAAGAAAAGAAGGTTTACAAATGA