Identifiers and Description

Gene Model Identifier

TTHERM_00564480

Standard Name

COI16 (COnjugation-Induced 16)

Aliases

PreTt08986 | 75.m00184 | 3721.m00066

Description

Specifically expressed during conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00564480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14600.15.000996804856152e-78hypothetical protein (391 aa)

General Information

Paragraph NoGene NameParagraph Text
111JUB1,
JUB2,
JUB3,
JUB4,
HPL2,
COI3,
COI6,
COI16,
JUB6
This protein co-localizes with Pdd1p in heterochromatin body in the new macronucleus.

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  2. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77

Sequences

>TTHERM_00564480(coding)
ATGGAAGTCGATATTAAGTTAAACTTACCCTTAAAATAAGTCCTATCCTCTCTTGAAAAT
TCAATCTTAAAATAGATATAATTATCTGAAAATAGCATTGATATTTAATCTTTAAGGGAT
GCTGTAGCTTAGTTTTAAAAAAATGTATAGGATCAAATAGAATAATTTAGTTAAAATGGT
AGCTTTAAGACCTCTGATGGTATGTCTTAGTTAAAAGATTCTACTACAAAAAATTTCTCA
AATAACTTATTGACTGGCAATAATAGTCAATAAAAATAGATTTAAGATAGTTATTATCAC
AGGTAGTTATTAAAAAGATCAAAAAACAATGAAAGTGAATCTGATTTTTATTAAAAATCT
GATGACAATTCTTCAAATTCCAATGATGATAACGATGACAGCGAAGGTTTCAGCTCTAAG
TACAATATTTTATCACCTAAAGACAAATAATATATCACCGAGTTTTTCAAAAGGCATTAT
GATCCTAGTAAGAGAAATAAGATGAAACTGGTTTAAGCTTGCTAAAAACGCATAAACTAA
TCATTTAATTCAATATATTCTATGATTACATATCTTATGAAAAGATATAAGTAAAAAAAT
AGAAACAGATCTAGCCAGAGATAACTTGATAGCAACAATAAACAACAATATTAAGGAAAA
TAGTAACAGCAAGATACTTCTGATGATATTGAAGACGAATATATTAATACAGGCCTAAAT
TTTTCTTTAAATTAAGAAAAAGAAAATGATTTAATAGATGAAGAGTCTATTAACAATCTG
ATAACAAAATATGAATTCATAAATGAAAAATACGATAGCAATAATTTTTCAAGGTAAGAA
TATTCAAACAGCAAAAACTATGAGACTAGATAATCAAGCAATCCCTAAAAATTTAGAGAG
AACTATCAATCCAACTAAAATTTTGAGTAAGTTAGAAATAACACAAATGGTAAATCTTAT
AAAATGGAAGAAAATCAACAAATGCTTAATAGACAGCTATAAAGCAGAGAATAAAATGGG
TAAAGCAAAAGTAATTATAATGATTAAAGAGATGTTGCATATAATAGCTATGATGAAAGT
TTTGATAATGACTTAGATTAAAAATTAAGCAAGAAGTATAATTGA


>TTHERM_00564480(protein)
MEVDIKLNLPLKQVLSSLENSILKQIQLSENSIDIQSLRDAVAQFQKNVQDQIEQFSQNG
SFKTSDGMSQLKDSTTKNFSNNLLTGNNSQQKQIQDSYYHRQLLKRSKNNESESDFYQKS
DDNSSNSNDDNDDSEGFSSKYNILSPKDKQYITEFFKRHYDPSKRNKMKLVQACQKRINQ
SFNSIYSMITYLMKRYKQKNRNRSSQRQLDSNNKQQYQGKQQQQDTSDDIEDEYINTGLN
FSLNQEKENDLIDEESINNLITKYEFINEKYDSNNFSRQEYSNSKNYETRQSSNPQKFRE
NYQSNQNFEQVRNNTNGKSYKMEENQQMLNRQLQSREQNGQSKSNYNDQRDVAYNSYDES
FDNDLDQKLSKKYN


>TTHERM_00564480(gene)
AAATATTAAATAAATTAAAAAAAATTTTAAATAAAATAAAAAATCATGGAAGTCGATATT
AAGTTAAACTTACCCTTAAAATAAGTCCTATCCTCTCTTGAAAATTCAATCTTAAAATAG
ATATAATTATCTGAAAATAGCATTGATATTTAATCTTTAAGGGATGCTGTAGCTTAGTTT
TAAAAAAATGTATAGGATCAAATAGAATAATTTAGTTAAAATGGTAGCTTTAAGACCTCT
GATGGTATGTCTTAGTTAAAAGATTCTACTACAAAAAATTTCTCAAATAACTTATTGACT
GGCAATAATAGTCAATAAAAATAGATTTAAGATAGTTATTATCACAGGTAGTTATTAAAA
AGATCAAAAAACAATGAAAGTGAATCTGATTTTTATTAAAAATCTGATGACAATTCTTCA
AATTCCAATGATGATAACGATGACAGCGAAGGTTTCAGCTCTAAGTACAATATTTTATCA
CCTAAAGACAAATAATATATCACCGAGTTTTTCAAAAGGCATTATGATCCTAGTAAGAGA
AATAAGATGAAACTGGTTTAAGCTTGCTAAAAACGCATAAACTAATCATTTAATTCAATA
TATTCTATGATTACATATCTTATGAAAAGATATAAGTAAAAAAATAGAAACAGATCTAGC
CAGAGATAACTTGATAGCAACAATAAACAACAATATTAAGGAAAATAGTAACAGCAAGAT
ACTTCTGATGATATTGAAGACGAATATATTAATACAGGCCTAAATTTTTCTTTAAATTAA
GAAAAAGAAAATGATTTAATAGATGAAGAGTCTATTAACAATCTGATAACAAAATATGAA
TTCATAAATGAAAAATACGATAGCAATAATTTTTCAAGGTAAGAATATTCAAACAGCAAA
AACTATGAGACTAGATAATCAAGCAATCCCTAAAAATTTAGAGAGAACTATCAATCCAAC
TAAAATTTTGAGTAAGTTAGAAATAACACAAATGGTAAATCTTATAAAATGGAAGAAAAT
CAACAAATGCTTAATAGACAGCTATAAAGCAGAGAATAAAATGGGTAAAGCAAAAGTAAT
TATAATGATTAAAGAGATGTTGCATATAATAGCTATGATGAAAGTTTTGATAATGACTTA
GATTAAAAATTAAGCAAGAAGTATAATTGA