Identifiers and Description

Gene Model Identifier

TTHERM_000420399

Standard Name

COI14 (Conjugation-induced gene 14)

Aliases

None

Description

specifically expressed during conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.4%

TetraMine Data

TTHERM_000420399

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

Paragraph NoGene NameParagraph Text
127AAP8,
COI14
Former TTHERM_00420400 contained TTHERM_00420400, TTHERM_000420399, and TTHERM_000420398. Woehrer et al (2015) called the former TTHERM_00420400 as COI14. The primers used for their gene expression analysis by RT-PCR are complementary to TTHERM_000420399. Therefore, TTHERM_000420399 takes over the name COI14. According to Saettone et al. (2018), the new TTHERM_00420400 is similar to Ada2-associated protein and thus now called AAP8.

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  2. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77

Sequences

>TTHERM_000420399(coding)
ATGAAAAATAATTTAAATTATATTTTTTATTTACTGAATTTTACTCCGAATAATTAAATA
AAAATTAGATATTTAGTGTATGATAGCTTATAATGTAATAAATTAAAATAATTGATTAAA
TGGAAGATAGTGTCAAATAGATAAAAATCATATTTGAAGAACTCAAGCAGTCTTATTATT
AGGAAAAGCTTTTAAATGAAGAACTTAACTCTGAGGTTACTATGCTAAGATAGGTTAAAA
GTATGTATGTAAACTAAATAGAGAAGCTAAATTAAGAAATATAATAGCTTATTTCAAATG
ATTTATAGAAACTCAATTTAAATAAGGATTACGAAGAAATGCTTGTCAAAAACAATGCTA
TTTAAATAGAAATGGAAAATATCTAATAAAATAATTAAGAAAAAGAACTTCTTTATAAAA
GACAAGTATACATGCTAGAGAGAGAAAATTAAGATTTTAGGGTATAAATTGAAAAATTGT
AGAAGCAACTATCTGATACAGAGAATGAAATTTCTGAGATGTTTAAAAAAATAACTTAAA
CGGGGTATGGTGAGCTATTGGCATGTAATTAAACGTTAATAAATAGGGTTAATTTACTAG
AAGAAAAACTATCTGAATAAAAGACATATATAGATAAATTAAAATAGCAAACCAGCGATG
AATTATCCAGATAAGCATTTAACTATGAAATTTTAGTTTAACAATATCAAACTCTCTAAA
GGGAAAATTAAAATTTAATTAGGTCTCAATCCAACTCAAAAAGCTATTACCAATTTTCAG
CTTAGAAAATAAATTAAGAAAATTCCAATTTGA


>TTHERM_000420399(protein)
MKNNLNYIFYLLNFTPNNQIKIRYLVYDSLQCNKLKQLIKWKIVSNRQKSYLKNSSSLII
RKSFQMKNLTLRLLCQDRLKVCMQTKQRSQIKKYNSLFQMIYRNSIQIRITKKCLSKTML
FKQKWKISNKIIKKKNFFIKDKYTCQREKIKILGYKLKNCRSNYLIQRMKFLRCLKKQLK
RGMVSYWHVIKRQQIGLIYQKKNYLNKRHIQINQNSKPAMNYPDKHLTMKFQFNNIKLSK
GKIKIQLGLNPTQKAITNFQLRKQIKKIPI


>TTHERM_000420399(gene)
ATGAAAAATAATTTAAATTATATTTTTTATTTACTGAATTTTACTCCGAATAATTAAATA
AAAATTAGATATTTAGTGTATGATAGCTTATAATGTAATAAATTAAAATAATTGATTAAA
TGGAAGATAGTGTCAAATAGATAAAAATCATATTTGAAGAACTCAAGCAGTCTTGTAAAA
ATCTATTTGTTTATTTTGGGATATTAACATTTATTTAGATTATTAGGAAAAGCTTTTAAA
TGAAGAACTTAACTCTGAGGTTACTATGCTAAGATAGGTTAAAAGTATGTATGTAAACTA
AATAGAGAAGCTAAATTAAGAAATATAATAGCTTATTTCAAATGATTTATAGAAACTCAA
TTTAAATAAGGATTACGAAGAAATGCTTGTCAAAAACAATGCTATTTAAATAGAAATGGA
AAATATCTAATAAGTAAATTTATTTTTTTTAAATTATACTTTCTAAAAATTATTTTATTG
AAAGAATAATTAAGAAAAAGAACTTCTTTATAAAAGACAAGTATACATGCTAGAGAGAGA
AAATTAAGATTTTAGGGTATAAATTGAAAAATTGTAGAAGCAACTATCTGATACAGAGAA
TGAAATTTCTGAGATGTTTAAAAAAATAACTTAAACGGGGTATGGTGAGCTATTGGCATG
TAATTAAACGTTAATAAATAGGGTTAATTTACTAGAAGAAAAACTATCTGAATAAAAGAC
ATATATAGATAAATTAAAATAGCAAACCAGCGATGAATTATCCAGATAAGCATTTAACTA
TGAAATTTTAGTTTAACAATATCAAACTCTCTAAAGGGAAAATTAAAATTTAATTAGGTC
TCAATCCAACTCAAAAAGCTATTACCAATTTTCAGCTTAGAAAATAAATTAAGAAAATTC
CAAGTAAATTACATTCATTTTATTTTTAAAATAAACATATAAAAATATTTTATCAAACAG
TTTGA