Identifiers and Description

Gene Model Identifier

TTHERM_00402050

Standard Name

COI12 (Conjugation-induced 12)

Aliases

PreTt12749 | 43.m00267 | 3713.m00093

Description

A Hsp90 co-chaperone required for the loading of scnRNAs to Twi1p

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07337 ) DC-EC Repeat
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF08180 ) B melanoma antigen family
  • ( PF02071 ) Aromatic-di-Alanine (AdAR) repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00402050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13976.11.999872053281847e-142hypothetical protein (544 aa)

General Information

Paragraph NoGene NameParagraph Text
103COI12The Tetrahymena Hsp90 co-chaperone Coi12p promotes scnRNA loading into the Argonaute protein Twi1p in both ATP-dependent and ATP-independent manners.
105GIW1,
COI12,
TWI1
ATP-dependent and ATP-independent activities of Coi12p facilitate scnRNA loading by counteracting the Twi1p-binding protein Giw1p, which is important for sorting scnRNAs to Twi1p (Woehrer et al. 2015).

Associated Literature

  1. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77
  2. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00402050(coding)
ATGTATTACTTGCCTAAAAGATACTTTTCCAAATAAATCAAATTTCAAATCAAACTCAAA
TTTGGTAGGAAATTAAATTTTCAAGCTAAATAAACTGCCCTCCCCAATAACTTTAATATT
TACATGTAAATCTATTTGATTGATTTTTAATTATTTCGTTCAATATATATAGCTAGCTAG
CTAGATAGATTGCTTTAAAGTAATTCAATCAATTTCAACAAAAAGATAATTACTTTAATT
AGCAAGGCTATTTTAAATATTAAAACAAACACTATTATATTAAAAATTAAATAAATTATA
ATTAAGCATTATTTCATTAAAAAATAAATAAAAGACATTAAAATGGATTCATCTAATGAA
AACACAAGGAGCTCTTCTTGTAATGAGTAGGAAACTAATTCAGAACTTTAGTAAAGTGTT
AATGAGAGTTGTACCAGCCTAGAAGAGTAGTAATTCAGCACTCCTTTTTTATCCAGCCAA
GAAACTGTATAGGTAGACTAAGCATTCTAAGAATCCACTAAATAGAATGAAGGAACTTCT
TCTTTCTTAAACGAGACCTAATGCTATCAAGATTGTAAGCCCAATTTAATTTCTAAAGGA
GAGTCAAATCAACAGTAATACAAAGAGTAAACTCAAGAAATTAGTGAGATTTTAGAAAAC
CCTTTTGCTTAAAATACACCAACTGATTAATGGAGCATTGTAGAAGAAAAAGATGGTAAT
AAACAAGCAGATAGTTTTGATATTTTATAAGACAAATTGATTAAAGAGGAAACATATAAC
ATCCCTAGTTGGAATTATGAGCCTTAAGATTTTAAAGCAGATATTGACTTTGAAAAATAT
GACAAAGAAAATCTAGATCACCTAAAGAAAGTCTACAAGCCTCCATAAATTGAAGACGTC
GTCGAAAAAGTAGAATAAGATGAAAATGGGCTTAAAATCTAAACTTTATCTTAATTCAAT
ATACCTAAATGCAATATACTGAAGCTTGATATGAGTTTTCTCTAAACTTGGCAATCAAAA
GAAATAGTACCATGCTTTACTATGTTTTCAGAACCAAAAACTAACAACGGGGAAAGTCTA
AATTGTGATGAAGAAGAAACTAATCCTTAGATTGATAAGAAATGGTGCAGAGATGTTTAA
GTTGTCTTTGAAGAAAGAGATTAGAATGGTGAGCTTATTGATAAATATAGAGTTGTCAAA
GAAAAAAGAACAGTTAAATTATAAGGAGATATATCAGCAAAGTGGTATATTTGTCTAGAG
CAGATGAAGCCAAATGAAACTAAGTGGTTTAAAATGGAATAAAAACTTCTTTGGCAGATT
GGACAAAAAAATTTAGCTTAATATGAGTGTATTTATCTAAAAATATAAATTGTTGGAGTA
AAGGCTCTTGCTCTTTCTGAAATGAAAGATAAACTTGAAAAAAATAACTTACAACCCTAA
CAGTAAAATATAATCTATGAGGATTATAGTTAAATAGCTCAGAAATCAGAAGAGTTTAAC
AATGAAGGAAAAATTCTATTCTCTATTATGAATTATGAAAAAGCTGCAAAATGGTTTAAC
AAAGCATTTAGTATTTGGAGAGGAATGAGCAAAAAGCTTAGAAAAACTTTAAATTCTGAA
TAGGAATAGAATTATATTGATAAGAGTAACTAGTTTGGTGCTAATTATGCATAATGCCTT
ATTAACCTCAAAAAATATTAAGAGTGTGTGGATTTTTACTAAAAAAACAAGCTTTCTTCT
AATAAGAACATTTATAAACTTGTAAAAAGTTTATATGAATTACATAACTATGAAAAAGCT
ATTTAAGTAATAGATAAACAGTTTCCTTAAAATGATGAAAACTCAGTTGATAAATTTATG
AACGGTAATCAAGAAAGTTTACTTCCAGCTGAATTCTAAAAGCTTAAAAGTCAGTGTTAA
GTAAAGCTAAAAATGTTAGAAAATCAATCAATAAATACATTTTATAGAAAATTGTTTTAA
TGA


>TTHERM_00402050(protein)
MYYLPKRYFSKQIKFQIKLKFGRKLNFQAKQTALPNNFNIYMQIYLIDFQLFRSIYIASQ
LDRLLQSNSINFNKKIITLISKAILNIKTNTIILKIKQIIIKHYFIKKQIKDIKMDSSNE
NTRSSSCNEQETNSELQQSVNESCTSLEEQQFSTPFLSSQETVQVDQAFQESTKQNEGTS
SFLNETQCYQDCKPNLISKGESNQQQYKEQTQEISEILENPFAQNTPTDQWSIVEEKDGN
KQADSFDILQDKLIKEETYNIPSWNYEPQDFKADIDFEKYDKENLDHLKKVYKPPQIEDV
VEKVEQDENGLKIQTLSQFNIPKCNILKLDMSFLQTWQSKEIVPCFTMFSEPKTNNGESL
NCDEEETNPQIDKKWCRDVQVVFEERDQNGELIDKYRVVKEKRTVKLQGDISAKWYICLE
QMKPNETKWFKMEQKLLWQIGQKNLAQYECIYLKIQIVGVKALALSEMKDKLEKNNLQPQ
QQNIIYEDYSQIAQKSEEFNNEGKILFSIMNYEKAAKWFNKAFSIWRGMSKKLRKTLNSE
QEQNYIDKSNQFGANYAQCLINLKKYQECVDFYQKNKLSSNKNIYKLVKSLYELHNYEKA
IQVIDKQFPQNDENSVDKFMNGNQESLLPAEFQKLKSQCQVKLKMLENQSINTFYRKLFQ


>TTHERM_00402050(gene)
ATGTATTACTTGCCTAAAAGATACTTTTCCAAATAAATCAAATTTCAAATCAAACTCAAA
TTTGGTAGGAAATTAAATTTTCAAGCTAAATAAACTGCCCTCCCCAATAACTTTAATATT
TACATGTAAATCTATTTGATTGATTTTTAATTATTTCGTTCAATATATATAGCTAGCTAG
CTAGATAGATTGCTTTAAAGTAATTCAATCAATTTCAACAAAAAGATAATTACTTTAATT
AGCAAGGCTATTTTAAATATTAAAACAAACACTATTATATTAAAAATTAAATAAATTATA
ATTAAGCATTATTTCATTAAAAAATAAATAAAAGACATTAAAATGGATTCATCTAATGAA
AACACAAGGAGCTCTTCTTGTAATGAGTAGGAAACTAATTCAGAACTTTAGTAAAGTGTT
AATGAGAGTTGTACCAGCCTAGAAGAGTAGTAATTCAGCACTCCTTTTTTATCCAGCCAA
GAAACTGTATAGGTAGACTAAGCATTCTAAGAATCCACTAAATAGAATGAAGGAACTTCT
TCTTTCTTAAACGAGACCTAATGCTATCAAGATTGTAAGCCCAATTTAATTTCTAAAGGA
GAGTCAAATCAACAGTAATACAAAGAGTAAACTCAAGAAATTAGTGAGATTTTAGAAAAC
CCTTTTGCTTAAAATACACCAACTGATTAATGGAGCATTGTAGAAGAAAAAGATGGTAAT
AAACAAGCAGATAGTTTTGATATTTTATAAGACAAATTGATTAAAGAGGAAACATATAAC
ATCCCTAGTTGGAATTATGAGCCTTAAGATTTTAAAGCAGATATTGACTTTGAAAAATAT
GACAAAGAAAATCTAGATCACCTAAAGAAAGTCTACAAGCCTCCATAAATTGAAGACGTC
GTCGAAAAAGTAGAATAAGATGAAAATGGGCTTAAAATCTAAACTTTATCTTAATTCAAT
ATACCTAAATGCAATATACTGAAGCTTGATATGAGTTTTCTCTAAACTTGGCAATCAAAA
GAAATAGTACCATGCTTTACTATGTTTTCAGAACCAAGTAAGATTCATTCCAGTTTTAAA
CTACTTCTACTTACTTACTTACTTATTATTATTTTTAATTAATTAGATTTAGTTTTAATT
TTGTAATTTTTGAATTTTCTGAATCTTTTTTTTTCAGTTTTTAAAATTTAAAATGAATAA
ATTTAATTAATTTACAATAAATTAAAAAATTTTTAAACATTTTATTTGAAAATTGGCTAA
AATTTGTTATATAGAAATAAAAAATATTCCAAAATTGTTTATTTCATGAAATATTTTATT
TAAAAATTAATCTAGAAACTAACAACGGGGAAAGTCTAAATTGTGATGAAGAAGAAACTA
ATCCTTAGATTGATAAGAAATGGTGCAGAGATGTTTAAGTTGTCTTTGAAGAAAGAGATT
AGAATGGTGAGCTTATTGATAAATATAGAGTTGTCAAAGAAAAAAGAACAGTTAAATTAT
AAGGAGATATATCAGCAAAGTGGTATATTTGTCTAGAGCAGATGAAGCCAAATGAAACTA
AGTGGTTTAAAATGGAATAAAAACTTCTTTGGCAGATTGGACAAAAAAATTTAGCTTAAT
ATGAGTGTATTTATCTAAAAATATAAATTGTTGGAGTAAAGGCTCTTGCTCTTTCTGAAA
TGAAAGATAAACTTGAAAAAAATAACTTACAACCCTAACAGTAAAATATAATCTATGAGG
ATTATAGTTAAATAGCTCAGAAATCAGAAGAGTTTAACAATGAAGGAAAAATTCTATTCT
CTATTATGAATTATGAAAAAGCTGCAAAATGGTTTAACAAAGCATTTAGTATTTGGAGAG
GAATGAGCAAAAAGCTTAGAAAAACTTTAAATTCTGAATAGGAATAGAATTATATTGATA
AGAGTAACTAGTTTGGTGCTAATTATGCATAATGCCTTATTAACCTCAAAAAATATTAAG
AGTGTGTGGATTTTTACTAAAAAAACAAGCTTTCTTCTAATAAGAACATTTATAAACTTG
TAAAAAGTTTATATGAATTACATAACTATGAAAAAGCTATTTAAGTAATAGATAAACAGT
TTCCTTAAAATGATGAAAACTCAGTTGATAAATTTATGAACGGTAATCAAGAAAGTTTAC
TTCCAGCTGAATTCTAAAAGCTTAAAAGTCAGTGTTAAGTAAAGCTAAAAATGTTAGAAA
ATCAATCAATAAATACATTTTATAGAAAATTGTTTTAATGA