Identifiers and Description

Gene Model Identifier

TTHERM_00189440

Standard Name

COI11 (Conjugation-induced)

Aliases

PreTt08694 | 15.m00405 | 3697.m00117

Description

Leucine Rich Repeat family protein, specifically expressed during conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00560 ) Leucine Rich Repeat
  • ( PF05073 ) Baculovirus P24 capsid protein
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00189440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06259.19.002954397174899e-30hypothetical protein (327 aa)
WormBaseWBGene000106210.000000009000371344152433locus:egg-6 Leucine-rich rep
eat-containing protein egg-6
status:Confirmed UniProt:P9
0920 protein_id:CAB03182.1
OxytrichaContig20952.0.g940.00000019998969434520019Leucine Rich repeats (2 copies
)
DictyBaseDDB_G02827250.000019995566179747357vilD on chromosome: 3 position
6207123 to 6212648
SGDYJL005W0.00003998524687536623CYR1 Adenylate cyclase, requir
ed for cAMP production and cAM
P-dependent protein kinase sig
naling; the cAMP pathway contr
ols a variety of cellular proc
esses, including metabolism, c
ell cycle, stress response, st
ationary phase, and sporulatio
n

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77
  2. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00189440(coding)
ATGTAAGTAGAACCTCAAAAAAGCAAAAGTATTAACCTCTCAAAAAAAGAGCTCAAAAGT
TTTAATAAGCTTCATCTTAAATAAAATGACATTAAAGAAATTGAAGAATTAAATCTTTCT
GCTAACAATATAGAGTCAACAGACAACATTTCACTTTTAACAAATCTGAAAGCTTTAAAC
ATTTCTTCGAATTTGCTTGTGAAAATGTACGGATTACCAAAATCATTAATATTATTAAAT
GCATCAAACAATAAAATAAATGAACTCTTTAGCATAAGGAATAATTAAGTACTTCAATCT
TGCTTTGATTAGATGGCTAATCTGACAATTCTTGATCTTTCCAAAAATAACATTGCTAAA
TTACATTCAAATCTATTTGATAATTGCAAGCACTTATCTGACATTGACTTGTCTCATAAC
AAAATTTCAGACTAATTAGAATGTTTTGTTAAATTACCTGACTTAATAAAATTGAATTTG
AGTTACAACAAAATAACAGATTTAAATTCTCTTTGCTAGCTAAAAGGATGCTTAGTTATA
GCACTTAACGTTTTATCTAATACTGTCACTAAACAAAACTCTTTACAGTGTGAGAATTTG
TTGAGAGCTATTTTACCCAATATCTAATCTCTGACTATTAACTAAGAAAGAAGTTTAACT
CCATAACCTATGAAAAATCAAAAAATTGAAAAAAATAAAAACAGCTCTGCACTTCCTGAC
AAAACTCAAAAATAATTTATATCCCCATTTAAAAAAAGATTGTCAATTGCAAGTACTGAT
AGCTCTACCAAAAATTTATCTGCATAAAGATAGCTTTAGTTTGATAATGTTTCTTTTATG
AGATAAGTTGATCCATAAAATGAAACTTAAGTTTTCTAAGACTTCATTCTCCTAAATAAT
TCTTTTGTTTAGCCTAGATAAGATATTCCCTAGAATGCATGTATTTTTAGCTCTGCATCT
CCATTTGATTATGTAGATAATCAGTAGAAAAAAATTAAATTGTAAGAAAACAATGAAAAT
GATGAGAAACTTCATAATCATAACAGCTGCTTAAAAAAAATATCTATCTTGCAACAAAAA
CAAAAGATGGATTAAGAACTTATCAACCAGTAAACTAAAATGATTTAAGATCTAGTTTTT
TGCAAAAATTGTGAGGAATAAAAAAAAATAAAATAAGTAGCATTAGAAGAGATATCGTTT
AAGGAGGATACAATGATTTAAAAATCATTTAATTTGACTTATTTAAAAGCTAAGTTTGAC
ATTTTAATGTTTGCCTTTTCAAAATAAACTAAATTGAACATTAATGAAATCGATGATTAT
CTAAAATAAGTAATTGGTGATAAAGTAATTTTAACGTCTGAATAGAAATGTTAGTTGGGA
TACTTAATTTGTGACAAGGTACATTCTGCAAATAATAGCAAATAATCATTTTGA


>TTHERM_00189440(protein)
MQVEPQKSKSINLSKKELKSFNKLHLKQNDIKEIEELNLSANNIESTDNISLLTNLKALN
ISSNLLVKMYGLPKSLILLNASNNKINELFSIRNNQVLQSCFDQMANLTILDLSKNNIAK
LHSNLFDNCKHLSDIDLSHNKISDQLECFVKLPDLIKLNLSYNKITDLNSLCQLKGCLVI
ALNVLSNTVTKQNSLQCENLLRAILPNIQSLTINQERSLTPQPMKNQKIEKNKNSSALPD
KTQKQFISPFKKRLSIASTDSSTKNLSAQRQLQFDNVSFMRQVDPQNETQVFQDFILLNN
SFVQPRQDIPQNACIFSSASPFDYVDNQQKKIKLQENNENDEKLHNHNSCLKKISILQQK
QKMDQELINQQTKMIQDLVFCKNCEEQKKIKQVALEEISFKEDTMIQKSFNLTYLKAKFD
ILMFAFSKQTKLNINEIDDYLKQVIGDKVILTSEQKCQLGYLICDKVHSANNSKQSF


>TTHERM_00189440(gene)
ATGTAAGTAGAACCTCAAAAAAGCAAAAGTATTAACCTCTCAAAAAAAGAGCTCAAAAGT
TTTAATAAGCTTCATCTTGTATTAATTATTTTAAAATTATTTTGAAACAATTTATTTAAA
TTATAAACAGAAATAAAATGACATTAAAGAAATTGAAGAATTAAATCTTTCTGCTAACAA
TATAGAGTCAACAGACAACATTTCACTTTTAACAAATCTGAAAGCTTTAAACATTTCTTC
GAATTTGCTTGTGAAAATGTACGGATTACCAAAATCATTAATATTATTAAATGCATCAAA
CAATAAAATAAATGAACTCTTTAGCATAAGGAATAATTAAGTACTTCAATCTTGCTTTGA
TTAGATGGCTAATCTGACAATTCTTGATCTTTCCAAAAATAACATTGCTAAATTACATTC
AAATCTATTTGATAATTGCAAGCACTTATCTGACATTGACTTGTCTCATAACAAAATTTC
AGACTAATTAGAATGTTTTGTTAAATTACCTGACTTAATAAAGTATTTTACTTTTAAAAA
TATTCATATTTATAATTAATTATTTTGTTAAATTTATTTTCTTAAAGATTGAATTTGAGT
TACAACAAAATAACAGATTTAAATTCTCTTTGCTAGCTAAAAGGATGCTTAGTTATAGCA
CTTAACGTTTTATCTAATACTGTCACTAAGTAACATTAGAAATCTTTCCAAAAAAACAAA
AATATTCTTTTTATAATAATAGACAAAACTCTTTACAGTGTGAGAATTTGTTGAGAGCTA
TTTTACCCAATATCTAATCTCTGACTATTAACTAAGAAAGAAGTTTAACTCCATAACCTA
TGAAAAATCAAAAAATTGAAAAAAATAAAAACAGCTCTGCACTTCCTGACAAAACTCAAA
AATAATTTATATCCCCATTTAAAAAAAGATTGTCAATTGCAAGTACTGATAGCTCTACCA
AAAATTTATCTGCATAAAGATAGCTTTAGTTTGATAATGTTTCTTTTATGAGATAAGTTG
ATCCATAAAATGAAACTTAAGTTTTCTAAGACTTCATTCTCCTAAATAATTCTTTTGTTT
AGCCTAGATAAGATATTCCCTAGAATGCATGTATTTTTAGCTCTGCATCTCCATTTGATT
ATGTAGATAATCAGTAGAAAAAAATTAAATTGTAAGAAAACAATGAAAATGATGAGAAAC
TTCATAATCATAACAGCTGCTTAAAAAAAATATCTATCTTGCAACAAAAACAAAAGATGG
ATTAAGAACTTATCAACCAGTAAACTAAAATGATTTAAGATCTAGTTTTTTGCAAAAATT
GTGAGGAATAAAAAAAAATAAAATAAGTAGCATTAGAAGAGATATCGTTTAAGGAGGATA
CAATGATTTAAAAATCATTTAATTTGACTTATTTAAAAGCTAAGTTTGACATTTTAATGT
TTGCCTTTTCAAAATGTAAATAAATAAATTTTTTAATTAAAACTTTAATTATTTTTTTTT
TACAATTAAATAAGAAACTAAATTGAACATTAATGAAATCGATGATTATCTAAAATAAGT
AATTGGTGATAAAGTAATTTTAACGTCTGAATAGAAATGTTAGTTGGGATACTTAATTTG
TGACAAGGTACATTCTGCAAATAATAGCAAATAATCATTTTGA