Identifiers and Description

Gene Model Identifier

TTHERM_01367700

Standard Name

COI10 (Conjugation-induced 10)

Aliases

PreTt01233 | 350.m00014

Description

a gene specifically expressed during conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR00192 ) urease, beta subunit
  • ( PF08946 ) Osmosensory transporter coiled coil

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01367700

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  2. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77

Sequences

>TTHERM_01367700(coding)
ATGCAAATGAAAAAAAGAATAATTGTAAAAAATCCTTAATAAGAGTAGAAGTCTATTTAA
TAAATTGATGTCACTTCTCTTTAAAAGGCCTTTGATCTTGAATAAAATTGTTTGAAATCA
GAATAAACTTAATCTTAAATAGGGTTATAAGGTCATAAGGGTTCTGAGAAGGAAATGCAA
AAGTCTAAAATAGTTTTAAATGGAAATTTGTAAAGCAAAAAAGAGTAATTAATTTAGACA
AACAAAAATGATATTAAAGTGAATTAAATGAATACCAACGAGGTTATTGACAAAAATAAA
TAGCTAACTAATACAAAAGAAGAACAATATCTGAATTAGCCTCATCTAAATCTTTTAAAA
AGTGAGAAAAAACCTATTAATTTTACAATATCTAAATCACCAAAACCGCATGCATAATAA
AATAATACATAAAATATTTAGAAAGTTAATGAAAGCATTGGTTCTTTTAAAAGTTCAAGC
GTCATTTCAGGCGATGTCTAAAAAGTGAGTGATTTCTAATCTAAAATGAATAGTCATACA
AGCTAATCTTAAGAAAGAAAAAATATTACTGATAAATAAGAGAAGTATAATTGCTAATAA
ACAATCTTAGTAGAAGTTAAACCTGTTAGTCAAGTAAAAAATGTTTAAAAGAAGAGCTAA
TTTTTAATTGAAATACCCTCTTTAGATAGTAACGAAAAAGCATAATAAGATAACCACAAA
ATGAAAGAGGATACTCTTAATAAATCATTTTGTTCATTTAGCACAGGTACGGCTGCAGTT
TAGATTTAACAAAAATAAAGTTTAAATAAATCATTTACTCATAATATATTTAATGATTCA
ATAAAAAATGATAAAAAACAATAAGATTTAATTAAGAGAATACTACCAGAGGATATATCA
TAAATAGAAACTTAAAAAGCAGGATTAAGAGAATTACATTAGAGCAAAAACAAGAACACA
TTAGATGTATAAAGCAGCAATTAAAGCTTTTTCAGCAATAACTAATTGAATCAAAAAATG
GGTAGTAATAAATAATAGCTTTAATAGAATAATATGAAGTAGTTAAGCTAGAATATTAAT
GATAATTAAGCAATTTAGCAATAAAACTAGGAAAAGCTAACAAATCCTTTGTTGGAATCT
AAAATAAGTTAAAAAAATATCTAAAACAGAATTGGCTAGCAAGTCTTTTAAGAGAAATAA
TTAATTTTGTTAGAAAATGTAGATAAAAGATCAAGCAGTTTAGAGGATGCTAAGCAGATC
AGTAATCATTTCAATTCAATTAATAAATTAGTCAAGAATAGCTTTGAATCTGCAAATCTG
TAATAATAACAAACATAGCCATTTTAGAATTAAGCATAAGCGGCTAATAAGTAGAAGATA
AACTAGAAAAAACGTAGAGAAGATAACAATGATAAACTGGATAAACTTATGGATGAGCTT
ATAAAATTGAATTAGAATAAACAAAATAAAAATCATTTCAATTTATAAAAGAAATAGAAA
ATCAATGAGCAATAAGTTAATTAAGACAATGAAAAGTAATATAATGAGTAAGACCTTTTG
AGCTTGAAGTAAACCAAACTTAACTAAATTTTCACAAATTCGCTTTAAAAGAGTGAAATT
AAAAGTGAATAATAAGAAACTAAAAATTAAACTAAAAAGTAGTCAAGGGAAGAGGAAAAT
TCAAAACTCTAAACTAGAAAATATCAATAAAGAAACGAGTTCGAATATAATACCTAAAAT
AATTAGTTATAAAAAAGCTAGTAGGATATTTTTGTTTAGCAAAAATAATTATAAAGAAGT
ACTTAAAATAATAATAATAATAACAACCAAAAAGAGCAGCTTAATAACCAAGAAAGTAGC
TTGATTAATAGCAGTTTCAACAACATTAAAGGTTAAATATCTTAGAATAATTTAAATTAA
GAATAAAAAAATCTTTAGTTGTAGATGCTAAAAGCGAAATAAAACATCAATAATTGTATT
AACTAAATTTTAGATAAATCTAATTAAAAAGATTCAGATCTGAATGTCATGGTTGCTGGA
AATATTGTTAGAGATGATATTTAAAAGAATTAAATTGTTATTGGAAGCAATGAAAAAATA
TATTCGATTGCTAGCAGTAATGAAGGTTTATGCGAAATATTAGAGTAAGATGTTAATTTA
TAAAAAAGCAAAGATTCAGCAATTAATTTGGTTTGTTAGAATTAATCAAGTTTATCAACT
TAAAATTTAGAAAGCAAAGAAAAATAATAAGATTAATAAAATTGTATGATAATACAAATA
GATAGCTCAAAGAGCTTGGAAAAAGATCAAATGGAAATTGAAAAAGAAGATAACAAACAA
GCGATTGCTACTCCTTTAGCTGAGAATAATCAAATGATGGAGAAAAAACATGCATTAGAA
ATCGAAATTAAGAAAATAAATCATGCTATTAAGTCTTTGGGTAAGAAAAAATTGAGCTTT
TTGAAAAATAGAGAAAGGAAAATATTAAAGTTAAAATCATATCTAATAAGATAAAAAAAT
TAAATTGATTAATAGCTTAAATAATACAACACTTAAAAACTCAACCAATTTATTAAGTAG
AAACAAGAGCTGCAATAAAAAATGTTAGAAGAAATGCTTAAAAAACAGTTAGAGCAACAG
CTAAATTAAGTGCAAAATAAAAAATCTTATTTCCAAAAATAACTAAAAAAGTGCTAGTTT
GTTGTTTAGAATGAAGTTAATTTTGATAATTATATTGTTATGGAAAATTAAAAGCGAGAA
ACAAAAAAAAGAAAATAAGAGGAAAAAGATTAACAAGATAAATAAAATAATCAATCAAAT
ATCAGCTAATCAAATCTTGATATGACTAAATCTGATCAAAATTCTGAAAATAAATTACTT
CCCCAATAAAATTGTGACAACAATGATAATTATTAAGACTAACAAATAATTAATGTTGAA
AAATAAGTCTAAATTGAATAAGATAGTGTCATTTAATAACAAAACCAAGAAATATTAGCT
GTTGATCAATAATAAAATGTTCCATTAAGAGAAAACTGCCATTCATAAAGCGAAAATTCA
AAGGAGAGAACTGAAAATAACACAAAAGATTTTACAATTTAATAAGAAATCTAAATAAAT
TAAGATAATTAAATTTAAATAGAAGAAGAGGAAATAAAATCAAGGAATTTATCTGAAGAA
AATAATGATTAGCAATACATTTAATTTAATTCTAGCAAGAATGAATAAGCTCAAAATGCT
TCACCAATAAGTACTAATTAATCTTGTATCTTAATCGATAGTAGTTCTTAAGCAACACCA
GAAGTGGAAGGAAAGTATTAAAATAACAATAACCTAAACAAAGTGAACCAATACTCTTCT
AATATTAATCCATCCGAAAACTCAAACAAGTACAATTGTGATTAACATCCTACCATAGAA
AGCTCAGTTTAAAATTTAAAGGTTTAAAATTCTGTACAATAAAAGCAAAAATAAAAAATG
GGTTGCGATTTAGATAAAACTTAAATTATAAATGTCGAAATAGAAAATAATATTAATATT
AATGAGGGAATTGAAGAAGAAAATTAAAAAAATATTTAAAATGATAAGATTCATCAGAAA
TAATTAGAAATTCCTTAAATAGGAGATGAGGATATCTTTGAAAGCAGAACTGATAAATAA
AAGAAATGTATTTAAGAAACAGTGATTATAGATGACCTATTTGAACCTGAAAATAAGATA
ACAAAACCAAAGGGAAAAGAATAAATAATTTGTACTAGTTTTAGCAGTAGTCAAGAAAAC
TTAAATAATGATCAAAGTTCATCTTAAATTAATTAGGATAAAAAATTTTAAGTTATAGTC
ATAGATGATTTGTTTATAGACAGATAAATTGGCTTTAATAAAGTTTAGGAAAACATTAAA
AACAGCACTTAATTATAAAAGCAAGAAAAAAATAATTAGTTACCATTAAAAATATAATAA
GATTAATAAGCTGTTAAAAGTGAAAGCAAATAGGAAAAGAAAATAAAAAAGAAAATGCAA
GAGAATTGGTTTCAAACAATTATTTCACTGATTAAAACGTGCTCATATTTCGGTCTATCT
GGATACTATCACACTATCTACAAGATGCAAGAATAATAAGAACTAGAGTCTTAGAAATAA
GTTTGTTAAGAACTTGATTTAAACTAATCAAATCAATTTAATATGTCAGGCAGAGTCTAA
ACTAGTAATCAGTAATATACATTTAGTTTTTACAAGCATCCAGACAATCTTAACAACAAA
TAATCTTAACCTATTTCAAATAATGATTAATAAATTAACCAAAATTTATCTTTGATTCGA
AATAAGTAAATTTTTGTTTCAAATAAAGACAGCTGTGTAAGCTCATAACAACCTAAAATA
ATAACTTTAAAGAACTTTATAATTAAGAAAAAAGAATAATAGAATGAAGATTATTAAAAT
TAAGCCACTATTTCAAGTTAAAAAAAATAAAATAATGATATGGATTTGCAAAATGAAGAG
ACTGAAAAATTAAATTGCTAAAAAGCTATGACTAAATCATCACCAAAATTAATTAGATTA
ACTTAACCTATTAAACACTTTAAAATTATTAAAAAATGA


>TTHERM_01367700(protein)
MQMKKRIIVKNPQQEQKSIQQIDVTSLQKAFDLEQNCLKSEQTQSQIGLQGHKGSEKEMQ
KSKIVLNGNLQSKKEQLIQTNKNDIKVNQMNTNEVIDKNKQLTNTKEEQYLNQPHLNLLK
SEKKPINFTISKSPKPHAQQNNTQNIQKVNESIGSFKSSSVISGDVQKVSDFQSKMNSHT
SQSQERKNITDKQEKYNCQQTILVEVKPVSQVKNVQKKSQFLIEIPSLDSNEKAQQDNHK
MKEDTLNKSFCSFSTGTAAVQIQQKQSLNKSFTHNIFNDSIKNDKKQQDLIKRILPEDIS
QIETQKAGLRELHQSKNKNTLDVQSSNQSFFSNNQLNQKMGSNKQQLQQNNMKQLSQNIN
DNQAIQQQNQEKLTNPLLESKISQKNIQNRIGQQVFQEKQLILLENVDKRSSSLEDAKQI
SNHFNSINKLVKNSFESANLQQQQTQPFQNQAQAANKQKINQKKRREDNNDKLDKLMDEL
IKLNQNKQNKNHFNLQKKQKINEQQVNQDNEKQYNEQDLLSLKQTKLNQIFTNSLQKSEI
KSEQQETKNQTKKQSREEENSKLQTRKYQQRNEFEYNTQNNQLQKSQQDIFVQQKQLQRS
TQNNNNNNNQKEQLNNQESSLINSSFNNIKGQISQNNLNQEQKNLQLQMLKAKQNINNCI
NQILDKSNQKDSDLNVMVAGNIVRDDIQKNQIVIGSNEKIYSIASSNEGLCEILEQDVNL
QKSKDSAINLVCQNQSSLSTQNLESKEKQQDQQNCMIIQIDSSKSLEKDQMEIEKEDNKQ
AIATPLAENNQMMEKKHALEIEIKKINHAIKSLGKKKLSFLKNRERKILKLKSYLIRQKN
QIDQQLKQYNTQKLNQFIKQKQELQQKMLEEMLKKQLEQQLNQVQNKKSYFQKQLKKCQF
VVQNEVNFDNYIVMENQKRETKKRKQEEKDQQDKQNNQSNISQSNLDMTKSDQNSENKLL
PQQNCDNNDNYQDQQIINVEKQVQIEQDSVIQQQNQEILAVDQQQNVPLRENCHSQSENS
KERTENNTKDFTIQQEIQINQDNQIQIEEEEIKSRNLSEENNDQQYIQFNSSKNEQAQNA
SPISTNQSCILIDSSSQATPEVEGKYQNNNNLNKVNQYSSNINPSENSNKYNCDQHPTIE
SSVQNLKVQNSVQQKQKQKMGCDLDKTQIINVEIENNININEGIEEENQKNIQNDKIHQK
QLEIPQIGDEDIFESRTDKQKKCIQETVIIDDLFEPENKITKPKGKEQIICTSFSSSQEN
LNNDQSSSQINQDKKFQVIVIDDLFIDRQIGFNKVQENIKNSTQLQKQEKNNQLPLKIQQ
DQQAVKSESKQEKKIKKKMQENWFQTIISLIKTCSYFGLSGYYHTIYKMQEQQELESQKQ
VCQELDLNQSNQFNMSGRVQTSNQQYTFSFYKHPDNLNNKQSQPISNNDQQINQNLSLIR
NKQIFVSNKDSCVSSQQPKIITLKNFIIKKKEQQNEDYQNQATISSQKKQNNDMDLQNEE
TEKLNCQKAMTKSSPKLIRLTQPIKHFKIIKK


>TTHERM_01367700(gene)
TAAAAAAATGCTCAATTTTCTTAATTAAGATATAAAAATTTTTAATTTAACAAAATATTT
TACAAAATGCAAATGAAAAAAAGAATAATTGTAAAAAATCCTTAATAAGAGTAGAAGTCT
ATTTAATAAATTGATGTCACTTCTCTTTAAAAGGCCTTTGATCTTGAATAAAATTGTTTG
AAATCAGAATAAACTTAATCTTAAATAGGGTTATAAGGTCATAAGGGTTCTGAGAAGGAA
ATGCAAAAGTCTAAAATAGTTTTAAATGGAAATTTGTAAAGCAAAAAAGAGTAATTAATT
TAGACAAACAAAAATGATATTAAAGTGAATTAAATGAATACCAACGAGGTTATTGACAAA
AATAAATAGCTAACTAATACAAAAGAAGAACAATATCTGAATTAGCCTCATCTAAATCTT
TTAAAAAGTGAGAAAAAACCTATTAATTTTACAATATCTAAATCACCAAAACCGCATGCA
TAATAAAATAATACATAAAATATTTAGAAAGTTAATGAAAGCATTGGTTCTTTTAAAAGT
TCAAGCGTCATTTCAGGCGATGTCTAAAAAGTGAGTGATTTCTAATCTAAAATGAATAGT
CATACAAGCTAATCTTAAGAAAGAAAAAATATTACTGATAAATAAGAGAAGTATAATTGC
TAATAAACAATCTTAGTAGAAGTTAAACCTGTTAGTCAAGTAAAAAATGTTTAAAAGAAG
AGCTAATTTTTAATTGAAATACCCTCTTTAGATAGTAACGAAAAAGCATAATAAGATAAC
CACAAAATGAAAGAGGATACTCTTAATAAATCATTTTGTTCATTTAGCACAGGTACGGCT
GCAGTTTAGATTTAACAAAAATAAAGTTTAAATAAATCATTTACTCATAATATATTTAAT
GATTCAATAAAAAATGATAAAAAACAATAAGATTTAATTAAGAGAATACTACCAGAGGAT
ATATCATAAATAGAAACTTAAAAAGCAGGATTAAGAGAATTACATTAGAGCAAAAACAAG
AACACATTAGATGTATAAAGCAGCAATTAAAGCTTTTTCAGCAATAACTAATTGAATCAA
AAAATGGGTAGTAATAAATAATAGCTTTAATAGAATAATATGAAGTAGTTAAGCTAGAAT
ATTAATGATAATTAAGCAATTTAGCAATAAAACTAGGAAAAGCTAACAAATCCTTTGTTG
GAATCTAAAATAAGTTAAAAAAATATCTAAAACAGAATTGGCTAGCAAGTCTTTTAAGAG
AAATAATTAATTTTGTTAGAAAATGTAGATAAAAGATCAAGCAGTTTAGAGGATGCTAAG
CAGATCAGTAATCATTTCAATTCAATTAATAAATTAGTCAAGAATAGCTTTGAATCTGCA
AATCTGTAATAATAACAAACATAGCCATTTTAGAATTAAGCATAAGCGGCTAATAAGTAG
AAGATAAACTAGAAAAAACGTAGAGAAGATAACAATGATAAACTGGATAAACTTATGGAT
GAGCTTATAAAATTGAATTAGAATAAACAAAATAAAAATCATTTCAATTTATAAAAGAAA
TAGAAAATCAATGAGCAATAAGTTAATTAAGACAATGAAAAGTAATATAATGAGTAAGAC
CTTTTGAGCTTGAAGTAAACCAAACTTAACTAAATTTTCACAAATTCGCTTTAAAAGAGT
GAAATTAAAAGTGAATAATAAGAAACTAAAAATTAAACTAAAAAGTAGTCAAGGGAAGAG
GAAAATTCAAAACTCTAAACTAGAAAATATCAATAAAGAAACGAGTTCGAATATAATACC
TAAAATAATTAGTTATAAAAAAGCTAGTAGGATATTTTTGTTTAGCAAAAATAATTATAA
AGAAGTACTTAAAATAATAATAATAATAACAACCAAAAAGAGCAGCTTAATAACCAAGAA
AGTAGCTTGATTAATAGCAGTTTCAACAACATTAAAGGTTAAATATCTTAGAATAATTTA
AATTAAGAATAAAAAAATCTTTAGTTGTAGATGCTAAAAGCGAAATAAAACATCAATAAT
TGTATTAACTAAATTTTAGATAAATCTAATTAAAAAGATTCAGATCTGAATGTCATGGTT
GCTGGAAATATTGTTAGAGATGATATTTAAAAGAATTAAATTGTTATTGGAAGCAATGAA
AAAATATATTCGATTGCTAGCAGTAATGAAGGTTTATGCGAAATATTAGAGTAAGATGTT
AATTTATAAAAAAGCAAAGATTCAGCAATTAATTTGGTTTGTTAGAATTAATCAAGTTTA
TCAACTTAAAATTTAGAAAGCAAAGAAAAATAATAAGATTAATAAAATTGTATGATAATA
CAAATAGATAGCTCAAAGAGCTTGGAAAAAGATCAAATGGAAATTGAAAAAGAAGATAAC
AAACAAGCGATTGCTACTCCTTTAGCTGAGAATAATCAAATGATGGAGAAAAAACATGCA
TTAGAAATCGAAATTAAGAAAATAAATCATGCTATTAAGTCTTTGGGTAAGAAAAAATTG
AGCTTTTTGAAAAATAGAGAAAGGAAAATATTAAAGTTAAAATCATATCTAATAAGATAA
AAAAATTAAATTGATTAATAGCTTAAATAATACAACACTTAAAAACTCAACCAATTTATT
AAGTAGAAACAAGAGCTGCAATAAAAAATGTTAGAAGAAATGCTTAAAAAACAGTTAGAG
CAACAGCTAAATTAAGTGCAAAATAAAAAATCTTATTTCCAAAAATAACTAAAAAAGTGC
TAGTTTGTTGTTTAGAATGAAGTTAATTTTGATAATTATATTGTTATGGAAAATTAAAAG
CGAGAAACAAAAAAAAGAAAATAAGAGGAAAAAGATTAACAAGATAAATAAAATAATCAA
TCAAATATCAGCTAATCAAATCTTGATATGACTAAATCTGATCAAAATTCTGAAAATAAA
TTACTTCCCCAATAAAATTGTGACAACAATGATAATTATTAAGACTAACAAATAATTAAT
GTTGAAAAATAAGTCTAAATTGAATAAGATAGTGTCATTTAATAACAAAACCAAGAAATA
TTAGCTGTTGATCAATAATAAAATGTTCCATTAAGAGAAAACTGCCATTCATAAAGCGAA
AATTCAAAGGAGAGAACTGAAAATAACACAAAAGATTTTACAATTTAATAAGAAATCTAA
ATAAATTAAGATAATTAAATTTAAATAGAAGAAGAGGAAATAAAATCAAGGAATTTATCT
GAAGAAAATAATGATTAGCAATACATTTAATTTAATTCTAGCAAGAATGAATAAGCTCAA
AATGCTTCACCAATAAGTACTAATTAATCTTGTATCTTAATCGATAGTAGTTCTTAAGCA
ACACCAGAAGTGGAAGGAAAGTATTAAAATAACAATAACCTAAACAAAGTGAACCAATAC
TCTTCTAATATTAATCCATCCGAAAACTCAAACAAGTACAATTGTGATTAACATCCTACC
ATAGAAAGCTCAGTTTAAAATTTAAAGGTTTAAAATTCTGTACAATAAAAGCAAAAATAA
AAAATGGGTTGCGATTTAGATAAAACTTAAATTATAAATGTCGAAATAGAAAATAATATT
AATATTAATGAGGGAATTGAAGAAGAAAATTAAAAAAATATTTAAAATGATAAGATTCAT
CAGAAATAATTAGAAATTCCTTAAATAGGAGATGAGGATATCTTTGAAAGCAGAACTGAT
AAATAAAAGAAATGTATTTAAGAAACAGTGATTATAGATGACCTATTTGAACCTGAAAAT
AAGATAACAAAACCAAAGGGAAAAGAATAAATAATTTGTACTAGTTTTAGCAGTAGTCAA
GAAAACTTAAATAATGATCAAAGTTCATCTTAAATTAATTAGGATAAAAAATTTTAAGTT
ATAGTCATAGATGATTTGTTTATAGACAGATAAATTGGCTTTAATAAAGTTTAGGAAAAC
ATTAAAAACAGCACTTAATTATAAAAGCAAGAAAAAAATAATTAGTTACCATTAAAAATA
TAATAAGATTAATAAGCTGTTAAAAGTGAAAGCAAATAGGAAAAGAAAATAAAAAAGAAA
ATGCAAGAGAATTGGTTTCAAACAATTATTTCACTGATTAAAACGTGCTCATATTTCGGT
CTATCTGGATACTATCACACTATCTACAAGATGCAAGAATAATAAGAACTAGAGTCTTAG
AAATAAGTTTGTTAAGAACTTGATTTAAACTAATCAAATCAATTTAATATGTCAGGCAGA
GTCTAAACTAGTAATCAGTAATATACATTTAGTTTTTACAAGCATCCAGACAATCTTAAC
AACAAATAATCTTAACCTATTTCAAATAATGATTAATAAATTAACCAAAATTTATCTTTG
ATTCGAAATAAGTAAATTTTTGTTTCAAATAAAGACAGCTGTGTAAGCTCATAACAACCT
AAAATAATAACTTTAAAGAACTTTATAATTAAGAAAAAAGAATAATAGAATGAAGATTAT
TAAAATTAAGCCACTATTTCAAGTTAAAAAAAATAAAATAATGATATGGATTTGCAAAAT
GAAGAGACTGAAAAATTAAATTGCTAAAAAGCTATGACTAAATCATCACCAAAATTAATT
AGATTAACTTAACCTATTAAACACTTTAAAATTATTAAAAAATGA