Identifiers and Description

Gene Model Identifier

TTHERM_00429890

Standard Name

CNPL1 (Conserved nucleoplasmin-like 1)

Aliases

PreTt26429 | 48.m00192 | 3831.m01535 | GTE3

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13%

TetraMine Data

TTHERM_00429890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04130.13.999244945363787e-60hypothetical protein (351 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:30796450: Ashraf K, Nabeel-Shah S, Garg J, Saettone A, Derynck J, Gingras AC, Lambert JP, Pearlman RE, Fillingham J (2019) Proteomic analysis of histones H2A/H2B and variant Hv1 in Tetrahymena thermophila reveals an ancient network of chaperones. Molecular biology and evolution ( ):
  2. Ref:SUPR000075
  3. Ref:SUPR000076

Sequences

>TTHERM_00429890(coding)
ATGTTCTGGGGTTGCACTGTTAAGAAAGGTAACGATCACAAGTTCGAATCTGAAGACCAC
GCTATTTTGCATCTTTCCAATGTTGCTTTGGGTTTAAATACTAAGGCCGGAGCTCAAGCT
TCCGTCTTTGCCAAAGTTGATGGAAAGGAATTCGTCATTACTCACTTGACCTAGGGTAAA
GTTGAACACACTACTCTCGATCTCTATTTTAGAAACGACCAAGAAGTCACTTTCGGTGTT
AAAGGAGAAGCTGAAGTTCACTTGAGTGGTTATTTCGAACCTGATCATGATGAAGAAGAT
CTTTATGATGATTATCCTTATGGCGAAGAAGAATTCGACGACGAAGAAGATGAAGAACTC
GAAGGAGAAGATGATGAAGATGACGATGAAGAGGAAGAAGAAGAAAAGCCTAAGCAACAA
CTCCAAAAGGAAGCTGCTAAGAAGCCAGCTGCCTAACAATAAGCTGCTGCTGCCACTAAA
AAGCCAGCTGAAGTTCAAAAGAAGGCTGAACCTGCTGCCAAGGCTGCTGAAGCAAAGAAG
CAACCTTCCCTTCAAGAAACTTTAGCCTTAAAGGCTGCTGCTGCTGCCAAGGCTAAGGAA
GCTTTGTAAAGTGATGAAGATGATGAAGACGATGATGATATGGATATTGATATGGAAGAT
GATGATGAAGAAGACGATGACGAAGAAGATTTCGATGATGAAGAAGAAGGTAATGATATC
GATGACGATGTTTCTGACTCTGACAATGAAAATGGAACTTTATCTTAAATGTTAAAGAGA
ACTGGTGCTGAATAACACTAAGACTTGAATAAGAAGGCCAAGGCCAACAACAACTAAGCT
GTTAACAAGCCTTAAAACTAAAACTAAAAGCCTTAATAATAAAACTAAAACCAAAAGCAA
AACAACCAACAATAAGGAAAGCCCCAACAATAACAATAAAACCAAAACAAGCAACAACAC
AATAACTAAAACAAGCAAAATCACTAATAACATCAAAACAAGCAAAACTAACATCAAAAC
AAGCAACACAACAACAACTAATAACATCACAACAAGAATTAACACCATCAAAATAAAAAT
CAACACAACAAAAATGCTCACAAAAAGAACTGA


>TTHERM_00429890(protein)
MFWGCTVKKGNDHKFESEDHAILHLSNVALGLNTKAGAQASVFAKVDGKEFVITHLTQGK
VEHTTLDLYFRNDQEVTFGVKGEAEVHLSGYFEPDHDEEDLYDDYPYGEEEFDDEEDEEL
EGEDDEDDDEEEEEEKPKQQLQKEAAKKPAAQQQAAAATKKPAEVQKKAEPAAKAAEAKK
QPSLQETLALKAAAAAKAKEALQSDEDDEDDDDMDIDMEDDDEEDDDEEDFDDEEEGNDI
DDDVSDSDNENGTLSQMLKRTGAEQHQDLNKKAKANNNQAVNKPQNQNQKPQQQNQNQKQ
NNQQQGKPQQQQQNQNKQQHNNQNKQNHQQHQNKQNQHQNKQHNNNQQHHNKNQHHQNKN
QHNKNAHKKN


>TTHERM_00429890(gene)
ATGTTCTGGGGTTGCACTGTTAAGAAAGGTAACGATCACAAGTTCGAATCTGAAGACCAC
GCTATTTTGCATCTTTCCAATGTTGCTTTGGGTTTAAATACTAAGGCCGGAGCTCAAGCT
TCCGTCTTTGCCAAAGTTGATGGAAAGGAATTCGTCATTACTCACTTGACCTAGGGTAAA
GTTGAACACACTACTCTCGATCTCTATTTTAGAAACGACCAAGAAGTCACTTTCGGTGTT
AAAGGAGAAGCTGAAGTTCACTTGAGTGGTTATTTCGAACCTGATCATGATGAAGAAGAT
CTTTATGATGATTATCCTTATGGCGAAGAAGAATTCGACGACGAAGAAGATGAAGAACTC
GAAGGAGAAGATGATGAAGATGACGATGAAGAGGAAGAAGAAGAAAAGCCTAAGCAACAA
CTCCAAAAGGAAGCTGCTAAGAAGCCAGCTGCCTAACAATAAGCTGCTGCTGCCACTAAA
AAGCCAGCTGAAGTTCAAAAGAAGGCTGAACCTGCTGCCAAGGCTGCTGAAGCAAAGAAG
CAACCTTCCCTTCAAGAAACTTTAGCCTTAAAGGCTGCTGCTGCTGCCAAGGCTAAGGAA
GCTTTGTAAAGTGATGAAGATGATGAAGACGATGATGATATGGATATTGATATGGAAGAT
GATGATGAAGAAGACGATGACGAAGAAGATTTCGATGATGAAGAAGAAGGTAATGATATC
GATGACGATGTTTCTGACTCTGACAATGAAAATGGAACTTTATCTTAAATGTTAAAGAGA
ACTGGTGCTGAATAACACTAAGACTTGAATAAGAAGGCCAAGGCCAACAACAACTAAGCT
GTTAACAAGCCTTAAAACTAAAACTAAAAGCCTTAATAATAAAACTAAAACCAAAAGCAA
AACAACCAACAATAAGGAAAGCCCCAACAATAACAATAAAACCAAAACAAGCAACAACAC
AATAACTAAAACAAGCAAAATCACTAATAACATCAAAACAAGCAAAACTAACATCAAAAC
AAGCAACACAACAACAACTAATAACATCACAACAAGAATTAACACCATCAAAATAAAAAT
CAACACAACAAAAATGCTCACAAAAAGAACTGA