Identifiers and Description

Gene Model Identifier

TTHERM_00483650

Standard Name

CNBL1 (Calcineurin B-Like 1)

Aliases

PreTt06299 | 58.m00271 | 3719.m00125

Description

EF hand family protein; homologous to Calcineurin B

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00483650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14243.15.001841681745041e-174EF hand family protein (285 aa
)
OxytrichaContig19341.0.0.g773.0007793728221555e-22EF-hand domain pair
Stentor CoeruleusSteCoe_280610.00000000003775134544279098
SGDYKL190W0.00000008001913847069386CNB1 Calcineurin B; the regula
tory subunit of calcineurin, a
Ca++/calmodulin-regulated typ
e 2B protein phosphatase which
regulates Crz1p (a stress-res
ponse transcription factor), t
he other calcineurin subunit i
s encoded by CNA1 and/or CMP1
DictyBaseDDB_G02859990.000000600201742947405cnbB on chromosome: 4 position
3918232 to 3919175
WormBaseWBGene000191080.00020003864201578029status:Confirmed UniProt:O16
343 protein_id:CCD67834.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00483650(coding)
ATGGGAGGATTATTAAGCAAAGGAAGTTATTTAGATGAAGTTGTTTATTTATCGAACTAA
AATGTAACGCCTTCGGACCTGAATATAATTTAGAAGGATACAGATTTCACAGAAAAGGAA
ATTTTAAACCTCTATTTCAGGTTTTATCAGCTGGATTAAAAGGAAAATCAAAAATTGTCA
ATAACTTAATTTCTCAACTTAGATGAACTCTAAAATTCGCCTTTCAAATCAAGGCTGATT
GATGGATTAGAATTAATAAAAGAGCAGTCAAAGTATCTTTAAGGTAAAAACCTTACTCTT
GATAATAATACTGGTTAAGAGGCTAGCAACTAGGAAAAGGCAGATTAAAAAAACTATTCT
AGAAGATAATCAAAAAGTGCTGCTGATTTGCCAAAGGCTAACTTTTTAAATTTTGCGTCT
GTAAATGGAACAAAAAAAAAACTATATAAAATAACTCCACTTAATAATAATACATAAGAA
GGAATTACTTCTAACAAATACTCATCCAAATAACTAAATTATTCTTTTATTGATTTCAAG
CTATTTTGTAAAATTTTAAATGTATTTTCAGCCAAAGCCTCATCTTCAAACAAATCGAGA
TTTCTATTCAGAATATTTGACTTCGATGAAGATGGTATGCTTAGTAAAGATGACTTAATT
AAAGGTATAACTCTCCTTTTTACAGATCCTCATACAGGGGAAAAATTAATGAACAAAAGT
GAAATTGAAAGATTAGCTGTAGCTGTGTTTAGTGAAACTGAAACAAATTAAGAAGGTTTC
CTTAAATATGAAGATTTATAGTTAAATCTATGGGAAACTGATTTTGAAAAAAACTGCACC
ATATATTTCTGA


>TTHERM_00483650(protein)
MGGLLSKGSYLDEVVYLSNQNVTPSDLNIIQKDTDFTEKEILNLYFRFYQLDQKENQKLS
ITQFLNLDELQNSPFKSRLIDGLELIKEQSKYLQGKNLTLDNNTGQEASNQEKADQKNYS
RRQSKSAADLPKANFLNFASVNGTKKKLYKITPLNNNTQEGITSNKYSSKQLNYSFIDFK
LFCKILNVFSAKASSSNKSRFLFRIFDFDEDGMLSKDDLIKGITLLFTDPHTGEKLMNKS
EIERLAVAVFSETETNQEGFLKYEDLQLNLWETDFEKNCTIYF


>TTHERM_00483650(gene)
ATGGGAGGATTATTAAGCAAAGGAAGTTATTTAGATGAAGTTGTTTATTTATCGAACTAA
AATGTAACGCCTTCGGACCTGAATATAATTTAGAAGGATACAGATTGTAAGATTCAAAAA
TATCTATCTATTTTTTTCCTTATTTCTACATAATAAATTTTAATAATCAAATTTACTAAA
AAAAGTCACAGAAAAGGAAATTTTAAACCTCTATTTCAGGTTTTATCAGCTGGATTAAAA
GGAAAATGTATTTTATTTAATTTTGATTTCACTTAAAACTTTATATTTTTACTATTTTTA
CTATTAAAAATGAAAATTTTCAGCAAAAATTGTCAATAACTTAATTTCTCAACTTAGATG
AACTCTAAAATTCGCCTTTCAAATCAAGGCTGATTGATGGATTAGAATTAATAAAAGAGC
AGTCAAAGTATCTTTAAGGTAAAAACCTTACTCTTGATAATAATACTGGTTAAGAGGCTA
GCAACTAGGAAAAGGCAGATTAAAAAAACTATTCTAGAAGATAATCAAAAAGTGCTGCTG
ATTTGCCAAAGGCTAACTTTTTAAATTTTGCGTCTGTAAATGGAACAAAAAAAAAACTAT
ATAAAATAACTCCACTTAATAATAATACATAAGAAGGAATTACTTCTAACAAATACTCAT
CCAAATAACTAAATTATTCTTTTATTGATTTCAAGCTATTTTGTAAAATTTTAAATGTAT
TTTCAGCCAAAGCCTCATCTTCAAACAAATCGAGATGTAAGTCTTTATATATTTATTTAT
TTATTATCAATTCAGTTAAAAATAAATAACAATTTATTTACTATTCACATAGTTCTATTC
AGAATATTTGACTTCGATGAAGATGGTATGCTTAGTAAAGATGACTTAATTAAAGGTATA
ACTCTCCTTTTTACAGATCCTCATACAGGGGAAAAATTAATGAACAAAAGTGAAATTGAA
AGATTAGCTGTAGCTGTGTTTAGTGAAACTGAAACAAATTAAGAAGGTTTCCTTAAATAT
GAAGATTTATAGTTAAATCTATGGGAAACTGATTTTGAAAAAAACTGCACCATATATTTC
TGA