Identifiers and Description

Gene Model Identifier

TTHERM_00146340

Standard Name

CNA1 (CENP-A like gene )

Aliases

PreTt26841 | 11.m00538 | 3702.m00260

Description

Centromeric histone similar to CENP-A; localized to peripheral centromeres in micronucleus; knockouts show abnormal mitotic segregation of micronucleus, leading to amicronucleate progeny

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00125 ) Core histone H2A/H2B/H3/H4
  • ( PF00808 ) Histone-like transcription factor (CBF/NF-Y) and

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00146340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04648.13.999498296699862e-96core histone H2A/H2B/H3/H4 fam
ily protein (187 aa)
DictyBaseDDB_G02674023.00033207980219e-32H3a on chromosome: 1 position
1520754 to 1521173
OxytrichaContig9358.0.g541.000137892321693e-31Core histone H2A/H2B/H3/H4
WormBaseWBGene000122764.9985000769285e-31locus:his-74 Histone H3.3-li
ke type 2 status:Confirmed
UniProt:Q27532 protein_id:C
AA98963.1
SGDYNL031C4.000352986427571e-28HHT2 Histone H3, core histone
protein required for chromatin
assembly, part of heterochrom
atin-mediated telomeric and HM
silencing; one of two identic
al histone H3 proteins (see HH
T1); regulated by acetylation,
methylation, and phosphorylat
ion
Stentor CoeruleusSteCoe_152870.000000000000012664165549094176

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16251352: Cervantes MD, Xi X, Vermaak D, Yao MC, Malik HS (2006) The CNA1 histone of the ciliate Tetrahymena thermophila is essential for chromosome segregation in the germline micronucleus. Molecular biology of the cell 17(1):485-97
  2. Ref:16738316: Cui B, Gorovsky MA (2006) Centromeric histone H3 is essential for vegetative cell division and for DNA elimination during conjugation in Tetrahymena thermophila. Molecular and cellular biology 26(12):4499-510

Sequences

>TTHERM_00146340(coding)
ATGGCTAGGAAAGCTTATTAACCAAAAAGGAGGAGTAATTCAAATCAAAATTAATAGAGA
TCTGATAGCCTGAAAAAAAATAAATAGGATAATTTGAGATCTAAATCTGCTGGGAATTAA
TAAGGGAATGAAAAAAACAAAAAAGATATTCAAGACCAAAGAAATAAAGCAAGTACAAAA
AAGAAAAGGGAGTCATCAGGAGAAAAATATGAGTCTGCAAGAGATAAAGTTATTAGAAGA
TTTAGGCCAGGGGATAATGCCCTTAAGCAATTAAGATAATATAATTAGACTCCATCATTG
CTAATAAGAAAATTACCCTTTTAGAGGTTAATAAGAGAGATTTCTACAAGAATGACAGAA
GAAGATTCGCTGAGATGGACAAGTTTTGCTCTGGTTTTACTTTAAACAGTTGTAGAAGAT
TATATGGTTTCATTTTTTGAAGATGCGAATGCTTGTGCTCTCCATGCTAAAAGAGTTACT
CTCATGTCTAAAGATCTTGCTCTTGCGGCAAGAATTAGGGGATAAAAAAATGTTACAGGT
ATATTTATCCCTACTAAAAAATGA


>TTHERM_00146340(protein)
MARKAYQPKRRSNSNQNQQRSDSLKKNKQDNLRSKSAGNQQGNEKNKKDIQDQRNKASTK
KKRESSGEKYESARDKVIRRFRPGDNALKQLRQYNQTPSLLIRKLPFQRLIREISTRMTE
EDSLRWTSFALVLLQTVVEDYMVSFFEDANACALHAKRVTLMSKDLALAARIRGQKNVTG
IFIPTKK


>TTHERM_00146340(gene)
ATGGCTAGGAAAGCTTATTAACCAAAAAGGAGGAGTAATTCAAATCAAAATTAATAGAGA
TCTGATAGCCTGAAAAAAAATAAATAGGATAATTTGAGATCTAAATCTGCTGGGAATTAA
TAAGGGAATGAAAAAAACAAAAAAGATATTCAAGACCAAAGAAATAAAGCAAGTACAAAA
AAGAAAAGGGAGTCATCAGGAGAAAAATATGAGTCTGCAAGAGATAAAGTTATTAGAAGA
TTTAGGCCAGGGGATAATGCCCTTAAGCAATTAAGATAATATAATTAGACTCCATCATTG
CTAATAAGAAAATTACCCTTTTAGAGGTTAATAAGAGAGATTTCTACAAGAATGACAGAA
GAAGATTCGCTGAGATGGACAAGTTTTGCTCTGGTTTTACTTTAAACAGTTGTAGAAGAT
TATATGGTTTCATTTTTTGAAGATGCGAATGCTTGTGCTCTCCATGCTAAAAGAGTTACT
CTCATGTCTAAAGATCTTGCTCTTGCGGCAAGAATTAGGGGATAAAAAAATGTTACAGGT
ATATTTATCCCTACTAAAAAATGA