Identifiers and Description

Gene Model Identifier

TTHERM_00146340

Standard Name

CNA1 (CENP-A-like 1)

Aliases

PreTt26841 | 11.m00538 | 3702.m00260

Description

Centromeric histone similar to CENP-A; localized to peripheral centromeres in micronucleus; knockouts show abnormal mitotic segregation of micronucleus, leading to amicronucleate progeny

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00125 ) Core histone H2A/H2B/H3/H4
  • ( PF00808 ) Histone-like transcription factor (CBF/NF-Y) and

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00146340

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( 23087207 ) Micronucleus: Neo2 into CNA1
  • ( SD01932 ) Micronucleus: Neo2 into CNA1
  • ( SD01933 ) Micronucleus: Neo2 into CNA1
  • ( SD01934 ) Micronucleus: Neo2 into CNA1
  • ( SD02693 ) Macronucleus: neo2 into CNA1
  • ( SD01812 ) Macronucleus: GFP tagged CNA1 from the MTT1 locus
  • ( SD01801 ) Micronucleus: DCL1 replaced by neo3 Macronucleus: CNA1 GFP tagged replaces MTT1 coding in MTT1 locus, bsr1 cassete in MTT1 5’
  • ( SD01802 ) Micronucleus: DCL1 replaced by neo3 Macronucleus: CNA1 GFP tagged replaces MTT1 coding in MTT1 locus, bsr1 cassete in MTT1 5’
  • ( SD01803 ) Micronucleus: DCL1 replaced by neo3 Macronucleus: CNA1 GFP tagged replaces MTT1 coding in MTT1 locus, bsr1 cassete in MTT1 5’
  • ( SD01804 ) Micronucleus: DCL1 replaced by neo3 Macronucleus: CNA1 GFP tagged replaces MTT1 coding in MTT1 locus, bsr1 cassete in MTT1 5’
  • ( SD01805 ) Micronucleus: DCL1 replaced by neo3 Macronucleus: CNA1 GFP tagged replaces MTT1 coding in MTT1 locus, bsr1 cassete in MTT1 5’
  • ( SD01806 ) Micronucleus: DCL1 replaced by neo3 Macronucleus: CNA1 GFP tagged replaces MTT1 coding in MTT1 locus, bsr1 cassete in MTT1 5’
  • ( SD01807 ) Micronucleus: DCL1 replaced by neo3 Macronucleus: CNA1 GFP tagged replaces MTT1 coding in MTT1 locus, bsr1 cassete in MTT1 5’
  • ( SD01813 ) "Micronucleus: ∆hht1 ; ∆hht2 ∆hhf1; ∆hhf2 Macronucleus: hybrid H3 replaces major H3. In MTT1 locus,GFP tagged CNA1"
  • ( SD01808 ) Micronucleus: TWI11replaced by neo3 Macronucleus: CNA1 GFP tagged replaces MTT1 coding in MTT1 locus, bsr1 cassete in MTT1 5’
  • ( SD01809 ) Micronucleus: TWI11replaced by neo3 Macronucleus: CNA1 GFP tagged replaces MTT1 coding in MTT1 locus, bsr1 cassete in MTT1 5’
  • ( SD01810 ) Micronucleus: TWI11 replaced by neo3 Macronucleus: CNA1 GFP tagged replaces MTT1 coding in MTT1 locus, bsr1 cassete in MTT1 5’
  • ( SD01811 ) Micronucleus: TWI11 replaced by neo3 Macronucleus: CNA1 GFP tagged replaces MTT1 coding in MTT1 locus, bsr1 cassete in MTT1 5’

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04648.13.999498296699862e-96core histone H2A/H2B/H3/H4 fam
ily protein (187 aa)
DictyBaseDDB_G02674023.00033207980219e-32H3a on chromosome: 1 position
1520754 to 1521173
OxytrichaContig9358.0.g541.000137892321693e-31Core histone H2A/H2B/H3/H4
WormBaseWBGene000122764.9985000769285e-31locus:his-74 Histone H3.3-li
ke type 2 status:Confirmed
UniProt:Q27532 protein_id:C
AA98963.1
SGDYNL031C4.000352986427571e-28HHT2 Histone H3, core histone
protein required for chromatin
assembly, part of heterochrom
atin-mediated telomeric and HM
silencing; one of two identic
al histone H3 proteins (see HH
T1); regulated by acetylation,
methylation, and phosphorylat
ion
Stentor CoeruleusSteCoe_152870.000000000000012664165549094176

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16738316: Cui B, Gorovsky MA (2006) Centromeric histone H3 is essential for vegetative cell division and for DNA elimination during conjugation in Tetrahymena thermophila. Molecular and cellular biology 26(12):4499-510
  2. Ref:16251352: Cervantes MD, Xi X, Vermaak D, Yao MC, Malik HS (2006) The CNA1 histone of the ciliate Tetrahymena thermophila is essential for chromosome segregation in the germline micronucleus. Molecular biology of the cell 17(1):485-97
  3. Ref:15701804: Liu Y, Song X, Gorovsky MA, Karrer KM (2005) Elimination of foreign DNA during somatic differentiation in Tetrahymena thermophila shows position effect and is dosage dependent. Eukaryotic cell 4(2):421-31
  4. Ref:15598983: Mochizuki K, Gorovsky MA (2005) A Dicer-like protein in Tetrahymena has distinct functions in genome rearrangement, chromosome segregation, and meiotic prophase. Genes & development 19(1):77-89

Sequences

>TTHERM_00146340(coding)
ATGGCTAGGAAAGCTTATTAACCAAAAAGGAGGAGTAATTCAAATCAAAATTAATAGAGA
TCTGATAGCCTGAAAAAAAATAAATAGGATAATTTGAGATCTAAATCTGCTGGGAATTAA
TAAGGGAATGAAAAAAACAAAAAAGATATTCAAGACCAAAGAAATAAAGCAAGTACAAAA
AAGAAAAGGGAGTCATCAGGAGAAAAATATGAGTCTGCAAGAGATAAAGTTATTAGAAGA
TTTAGGCCAGGGGATAATGCCCTTAAGCAATTAAGATAATATAATTAGACTCCATCATTG
CTAATAAGAAAATTACCCTTTTAGAGGTTAATAAGAGAGATTTCTACAAGAATGACAGAA
GAAGATTCGCTGAGATGGACAAGTTTTGCTCTGGTTTTACTTTAAACAGTTGTAGAAGAT
TATATGGTTTCATTTTTTGAAGATGCGAATGCTTGTGCTCTCCATGCTAAAAGAGTTACT
CTCATGTCTAAAGATCTTGCTCTTGCGGCAAGAATTAGGGGATAAAAAAATGTTACAGGT
ATATTTATCCCTACTAAAAAATGA


>TTHERM_00146340(protein)
MARKAYQPKRRSNSNQNQQRSDSLKKNKQDNLRSKSAGNQQGNEKNKKDIQDQRNKASTK
KKRESSGEKYESARDKVIRRFRPGDNALKQLRQYNQTPSLLIRKLPFQRLIREISTRMTE
EDSLRWTSFALVLLQTVVEDYMVSFFEDANACALHAKRVTLMSKDLALAARIRGQKNVTG
IFIPTKK


>TTHERM_00146340(gene)
ATGGCTAGGAAAGCTTATTAACCAAAAAGGAGGAGTAATTCAAATCAAAATTAATAGAGA
TCTGATAGCCTGAAAAAAAATAAATAGGATAATTTGAGATCTAAATCTGCTGGGAATTAA
TAAGGGAATGAAAAAAACAAAAAAGATATTCAAGACCAAAGAAATAAAGCAAGTACAAAA
AAGAAAAGGGAGTCATCAGGAGAAAAATATGAGTCTGCAAGAGATAAAGTTATTAGAAGA
TTTAGGCCAGGGGATAATGCCCTTAAGCAATTAAGATAATATAATTAGACTCCATCATTG
CTAATAAGAAAATTACCCTTTTAGAGGTTAATAAGAGAGATTTCTACAAGAATGACAGAA
GAAGATTCGCTGAGATGGACAAGTTTTGCTCTGGTTTTACTTTAAACAGTTGTAGAAGAT
TATATGGTTTCATTTTTTGAAGATGCGAATGCTTGTGCTCTCCATGCTAAAAGAGTTACT
CTCATGTCTAAAGATCTTGCTCTTGCGGCAAGAATTAGGGGATAAAAAAATGTTACAGGT
ATATTTATCCCTACTAAAAAATGA