Identifiers and Description

Gene Model Identifier

TTHERM_00102830

Standard Name

CMT2 (mRNA Cap guanine-N7 MethylTransferase 2)

Aliases

PreTt22983 | 7.m00432

Description

Methyltransferase; catalyzes transfer of methyl group from S-adenosylmethionine to GpppN terminus of capped mRNA

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08241 ) methyltransferase domain
  • ( PF03291 ) mRNA capping enzyme, large subunit
  • ( TIGR02863 ) small, acid-soluble spore protein, SspJ

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00102830

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00335.19.997093137033517e-262hypothetical protein (667 aa)
OxytrichaContig18517.0.g334.001630327199692e-20mRNA capping enzyme
SGDYBR236C0.00000019998969434520019ABD1 Methyltransferase, cataly
zes the transfer of a methyl g
roup from S-adenosylmethionine
to the GpppN terminus of capp
ed mRNA

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000107

Sequences

>TTHERM_00102830(coding)
ATGAATCATAGAAATTCTAATTACAAGCTAAACAGATACAATAACAATAACAACAATAGT
AATTCTTATCCAGCCTTCCGTTAGGACAATTAAAACCGTGGTGGCGGAGATAGAGGAAAT
TACAACTAAGGAGGATCAAACAATAATAACAGTTCTAATAGCAATAACAATCCTAATAAC
TACTACAATCATTAGAATCCAAGTGGTGGCAATAGCTATCAAAGCGGAAGTGGAAACCAT
GGCAATTATGGAGGTGAAACTTACTAAAATTCTGATAGACGTGGCGGAGATAACAGAAGA
GGAGGTGGATATGGCAATAAAGACAGATATGCTTCTTCAGGTGATAACTACCACGGTAGT
CATGGAGGTAGTGGCACTAATAACCACCATGGAAACGGCGGCTATTAAAACAATAATAAC
AGCAGTTACAATTAAGGTGGATACAGTGGAAATAATCACAGTAGCGGAGGCAGCAGAGGT
GGATATCATCATAACGATAATAGAAGATAACACAACAACAACAACAATAATAATAGCAAC
AATAACAGCAACTTAAATAACTAGCGTGGAAGCGGTGGAAGTGGTAAAATGAGAGGAGAT
AGAAACTACGATAGAAGAAGATAAGACAGAAACAATAACAGATCTTCAAATCACTACTCT
GGCGGTAATCAAGGAGGTTCTCATCATGGAGGAAATCACAGAAATAACGCAGGAGGTCAC
CACGGCGGACATGGTCATCACAACAATAGTGGACATAACAACCATCATCACCAATCTTCT
TCTAATAATTAAGTTCAGAACTTCTACAATAATAATAAGGGATTCAATTAGTAGGAAAGA
AAGAATTTAGAAACCTTCCATATCAGAGTCTTCCATAATTGGGTAAAGAGTGTTCTTATT
CAGAAATATGGTGAGATATAGAGATCTATTGTCAAAGCAGAGAATGCCAAATTACCTGAA
AATTATTTATACATTTTGGACTTGGCTTGTGGTAAGGGTGGTGACCACAAAAAGTGGTTA
ATGCATAGTCATGCTTGCTTTTACATTGGTGTTGATATTGCCATGGAAGCATTAAACTAA
GCATACTAGAGAGCAATAATCACTTTAAACGAAATTAAATAAAACAGTCGCTATCATTCC
AACATTAAATTCGGGTTCTTCTAAAAAGATTGTTCTTGTTCAAGCGAAGATTTTTGGAAG
CACATTAACGCTCCTCCAAATAATGCACTCACTGCTGCTGAGAACGAAGCTTAAGGATCT
GAATTGAAAGAAGATGGTAATGAGAAGAACGAAAATAAGCCAAATAATGAAGATTAAATG
GATCTTGAAGGAGGAAATAAAAAAGAAAATGAAGAAACTAATTAAGATGAAGGCTAATCA
CCTAAAAAGGAAGAAAATAATGAAAAAGAATAAAATAAAGATAAAGAATAGTATGGTAAA
TATATGTTCGATGTTGTTTCCTGTTAAATGGCTATGCATTACATGCATGAAAGTGAAGAA
AAAGTAAGAAATTTCTTAGATAATTGCACAAAAAGATTAAACGATTAAGGCTTCTTGCTT
TTAACTTTCACAGACGGTAATGCTGTCTTAGATATTATGAAGAGCAAAGGTCAACCTACT
CCTGAAGGTGGTACTATTTATTCAAGCAAACACTTCAGTATGAAATTTGATAATCCTGTT
GAATAAATTGATCTCCAATAAAATCCTTATGGTAACAAATACGGATTCTACTTACAAGAG
TCAGTTGGTTCTTAAGTCGAAGGAGTTATCAAATACGTTCCTGAATATCTAGTAAATGTT
GACTTGTTCATTGAAACTGCAAAAGAATACTCCTTAGAAGTAAAGGAAAATAACCTTCTA
ACTGACTTCTACGAAAATAACAAGACTCCATTTGCTGACCTCTTAAAGTAAATGAAGGTA
ACTTACTCTCAAGAAGAAGAATAGAAAGATCCTTTCTCCTGGGAAGTTTCTCACTGCTAC
CGTGCCGTAGTATTTTAGAAGGTCTTAGCTCAACCCAACAGATATTAGTTTGATAGATCC
ACTCGTGACAAATACTTACTCAAATATCCTGTCCAACTTAATTACTCTCCTAAGAAGAAA
GAAGATTGA


>TTHERM_00102830(protein)
MNHRNSNYKLNRYNNNNNNSNSYPAFRQDNQNRGGGDRGNYNQGGSNNNNSSNSNNNPNN
YYNHQNPSGGNSYQSGSGNHGNYGGETYQNSDRRGGDNRRGGGYGNKDRYASSGDNYHGS
HGGSGTNNHHGNGGYQNNNNSSYNQGGYSGNNHSSGGSRGGYHHNDNRRQHNNNNNNNSN
NNSNLNNQRGSGGSGKMRGDRNYDRRRQDRNNNRSSNHYSGGNQGGSHHGGNHRNNAGGH
HGGHGHHNNSGHNNHHHQSSSNNQVQNFYNNNKGFNQQERKNLETFHIRVFHNWVKSVLI
QKYGEIQRSIVKAENAKLPENYLYILDLACGKGGDHKKWLMHSHACFYIGVDIAMEALNQ
AYQRAIITLNEIKQNSRYHSNIKFGFFQKDCSCSSEDFWKHINAPPNNALTAAENEAQGS
ELKEDGNEKNENKPNNEDQMDLEGGNKKENEETNQDEGQSPKKEENNEKEQNKDKEQYGK
YMFDVVSCQMAMHYMHESEEKVRNFLDNCTKRLNDQGFLLLTFTDGNAVLDIMKSKGQPT
PEGGTIYSSKHFSMKFDNPVEQIDLQQNPYGNKYGFYLQESVGSQVEGVIKYVPEYLVNV
DLFIETAKEYSLEVKENNLLTDFYENNKTPFADLLKQMKVTYSQEEEQKDPFSWEVSHCY
RAVVFQKVLAQPNRYQFDRSTRDKYLLKYPVQLNYSPKKKED


>TTHERM_00102830(gene)
ATGAATCATAGAAATTCTAATTACAAGCTAAACAGATACAATAACAATAACAACAATAGT
AATTCTTATCCAGCCTTCCGTTAGGACAATTAAAACCGTGGTGGCGGAGATAGAGGAAAT
TACAACTAAGGAGGATCAAACAATAATAACAGTTCTAATAGCAATAACAATCCTAATAAC
TACTACAATCATTAGAATCCAAGTGGTGGCAATAGCTATCAAAGCGGAAGTGGAAACCAT
GGCAATTATGGAGGTGAAACTTACTAAAATTCTGATAGACGTGGCGGAGATAACAGAAGA
GGAGGTGGATATGGCAATAAAGACAGATATGCTTCTTCAGGTGATAACTACCACGGTAGT
CATGGAGGTAGTGGCACTAATAACCACCATGGAAACGGCGGCTATTAAAACAATAATAAC
AGCAGTTACAATTAAGGTGGATACAGTGGAAATAATCACAGTAGCGGAGGCAGCAGAGGT
GGATATCATCATAACGATAATAGAAGATAACACAACAACAACAACAATAATAATAGCAAC
AATAACAGCAACTTAAATAACTAGCGTGGAAGCGGTGGAAGTGGTAAAATGAGAGGAGAT
AGAAACTACGATAGAAGAAGATAAGACAGAAACAATAACAGATCTTCAAATCACTACTCT
GGCGGTAATCAAGGAGGTTCTCATCATGGAGGAAATCACAGAAATAACGCAGGAGGTCAC
CACGGCGGACATGGTCATCACAACAATAGTGGACATAACAACCATCATCACCAATCTTCT
TCTAATAATTAAGTTCAGAACTTCTACAATAATAATAAGGGATTCAATTAGTAGGAAAGA
AAGAATTTAGAAACCTTCCATATCAGAGTCTTCCATAATTGGGTAAAGAGTGTTCTTATT
CAGAAATATGGTGAGATATAGAGATCTATTGTCAAAGCAGAGAATGCCAAATTACCTGAA
AATTATTTATACATTTTGGACTTGGCTTGTGGTAAGGGTGGTGACCACAAAAAGTGGTTA
ATGCATAGTCATGCTTGCTTTTACATTGGTGTTGATATTGCCATGGAAGCATTAAACTAA
GCATACTAGAGAGCAATAATCACTTTAAACGAAATTAAATAAAACAGTCGCTATCATTCC
AACATTAAATTCGGGTTCTTCTAAAAAGATTGTTCTTGTTCAAGCGAAGATTTTTGGAAG
CACATTAACGCTCCTCCAAATAATGCACTCACTGCTGCTGAGAACGAAGCTTAAGGATCT
GAATTGAAAGAAGATGGTAATGAGAAGAACGAAAATAAGCCAAATAATGAAGATTAAATG
GATCTTGAAGGAGGAAATAAAAAAGAAAATGAAGAAACTAATTAAGATGAAGGCTAATCA
CCTAAAAAGGAAGAAAATAATGAAAAAGAATAAAATAAAGATAAAGAATAGTATGGTAAA
TATATGTTCGATGTTGTTTCCTGTTAAATGGCTATGCATTACATGCATGAAAGTGAAGAA
AAAGTAAGAAATTTCTTAGATAATTGCACAAAAAGATTAAACGATTAAGGCTTCTTGCTT
TTAACTTTCACAGACGGTAATGCTGTCTTAGATATTATGAAGAGCAAAGGTCAACCTACT
CCTGAAGGTGGTACTATTTATTCAAGCAAACACTTCAGTATGAAATTTGATAATCCTGTT
GAATAAATTGATCTCCAATAAAATCCTTATGGTAACAAATACGGATTCTACTTACAAGAG
TCAGTTGGTTCTTAAGTCGAAGGAGTTATCAAATACGTTCCTGAATATCTAGTAAATGTT
GACTTGTTCATTGAAACTGCAAAAGAATACTCCTTAGAAGTAAAGGAAAATAACCTTCTA
ACTGACTTCTACGAAAATAACAAGACTCCATTTGCTGACCTCTTAAAGTAAATGAAGGTA
ACTTACTCTCAAGAAGAAGAATAGAAAGATCCTTTCTCCTGGGAAGTTTCTCACTGCTAC
CGTGCCGTAGTATTTTAGAAGGTCTTAGCTCAACCCAACAGATATTAGTTTGATAGATCC
ACTCGTGACAAATACTTACTCAAATATCCTGTCCAACTTAATTACTCTCCTAAGAAGAAA
GAAGATTGA