Identifiers and Description

Gene Model Identifier

TTHERM_00431250

Standard Name

CMT1 (mRNA cap guanine-N7 methyltransferase 1)

Aliases

PreTt26466 | 48.m00229 | 3831.m01569 | ABD1

Description

Methyltransferase, catalyzes the transfer of a methyl group from S-adenosylmethionine to the GpppN terminus of capped mRNA

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00431250

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04157.19.997093137033517e-262hypothetical protein (567 aa)
OxytrichaContig18517.0.g335.0019039340728934e-39mRNA capping enzyme
SGDYBR236C3.999672240330216e-26ABD1 Methyltransferase, cataly
zes the transfer of a methyl g
roup from S-adenosylmethionine
to the GpppN terminus of capp
ed mRNA
DictyBaseDDB_G02784794.0013320766793207e-25DDB_G0278479 on chromosome: 3
position 936199 to 937743
WormBaseWBGene000064478.99902975825788e-19locus:tag-72 mRNA cap guanin
e-N7 methyltransferase statu
s:Confirmed UniProt:Q9XVS1
protein_id:CAB02758.2

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000107

Sequences

>TTHERM_00431250(coding)
ATGAGCGAGGATGAATCTGATGGATTAAATTTCGATGAAGATGAAAACTCCCCCAAATTT
AAGCCATAAGCTTCTATTGAACAAGATGATAAACCTGAATTTTTGTCATAACCTTCAGAT
AGTGAAAGCAATTAAAACATAAAATCAAATAATTAAAAAGTGAATAAATAGCAAAAAAGT
GCATCAAAAGCAAATAAATTCTCTGATGATGATGATGCAGAACTTTCTGATATATTCGAT
AGTGACGATGATGATGATAGCAATAAGAAACCATAAAAATAGAAGCAAATTCATAAAGAT
AAATAAAATGATGTTAAAAAAATCTAAGAACGTAAGACAATGTAGTAAGTAAGAGAAAGG
CATGACAATAGTGGAGAAAAAAAAAGATCAACTATGTAGTAAAGAAATTAGAATTCAGCA
ACAAAAAAATAATAAAAAACTAGCAGCAATAATAGCAATTATCAAAGTAATAAAAAAAGT
GAAGGCCCTTCTTCTGCACCTTAAAATGTTGTTATTGATAAAGTAACTAATTAGAGAGTA
ACAGAGCAATAAAAAACTATTCAATCAGGATATGAAAAGAAGGAAGCGCTAACTGTTCTC
ACTCGTTCAGTTCTTGAAACTGCGGAATTACGTAACTTTCATAACTGGATTAAGAGTGTG
ATTATTAAGAAGTATTCTGATGATATGAAGCAAATTATTAAAAAAAAAGAAGATCTCCGT
ACAGAAACAGGTTAGCTTTTCGTCATGGAAATTGCATGTGGTTAGGGTGGTGATTTGAAG
AAATGGCTTCATGCTGATATAGGCTTGTATGTGGGTGTTGATATTTCTTTTAATTCTTTA
AAAGAAGCTTCTCGTAGAACTAAAGATATTATGGAAAAGTTACCTCCACACTGGAATTAC
AAAAAATTTAAGTATGGATTTTACTAAAAAGATGGTTCAGCATCTACTGATGAGTTTTGG
AAACACATTCACGATAAAGATAAAGATTAAGATAAATCCAAGAGGTTTTTCTTTGATATA
GTAAGTTGCCAGATGGCTATGCATTACATGTTTGGCAGTGAACAGCATGCTAGAAACTTC
TTTTCTAATGCCACTTAGAGACTAAATGACTAAGGCTATCTGCTTGTTACTTGCTCTGAT
TCAAATGCAATTGTAAAAAAAATGCGTTCTAGAGGTAAGCTTGACTCTACTAACAACAAA
TATACCTTTGGAAACAAATACTTCTCTATGGCATTTGAGAATTTGAATTTTCCTGTCGGA
AAACCTTACGGTTTAAAATATGAATTTTATCTACAAGATGCAGTTGGTGAAAAAGATGAA
GCAACTGGATAAATTAAATACACTCCTGAATACCTTGTTGAATTGAATAATCTTAACAAA
TTAGCTATGGAATATTCATTAGTTGTTAAAGAAAACCTTAACTTCATAGAATTCTATAAA
AATTACAGAAATAAATACGGATACCTTTTTAAATCTATGGGTTTGGATAAGTTTACTAAT
GATCATCCTTCAATCGATCCAGAGCTTTGGGAAATCTCTCACTGCTATAGAGTAATCGTT
TTCTAAAAGGTAGATCTTGCTAACAGAGATAATAAGAAATACTAATTTATACGTAATCCT
AACATCAAATAGCTAGCATAAGATCCTATACCAATAAATTATGTACCCTCAGCACCTGAA
AAACGTCCTTTCAAACACTGA


>TTHERM_00431250(protein)
MSEDESDGLNFDEDENSPKFKPQASIEQDDKPEFLSQPSDSESNQNIKSNNQKVNKQQKS
ASKANKFSDDDDAELSDIFDSDDDDDSNKKPQKQKQIHKDKQNDVKKIQERKTMQQVRER
HDNSGEKKRSTMQQRNQNSATKKQQKTSSNNSNYQSNKKSEGPSSAPQNVVIDKVTNQRV
TEQQKTIQSGYEKKEALTVLTRSVLETAELRNFHNWIKSVIIKKYSDDMKQIIKKKEDLR
TETGQLFVMEIACGQGGDLKKWLHADIGLYVGVDISFNSLKEASRRTKDIMEKLPPHWNY
KKFKYGFYQKDGSASTDEFWKHIHDKDKDQDKSKRFFFDIVSCQMAMHYMFGSEQHARNF
FSNATQRLNDQGYLLVTCSDSNAIVKKMRSRGKLDSTNNKYTFGNKYFSMAFENLNFPVG
KPYGLKYEFYLQDAVGEKDEATGQIKYTPEYLVELNNLNKLAMEYSLVVKENLNFIEFYK
NYRNKYGYLFKSMGLDKFTNDHPSIDPELWEISHCYRVIVFQKVDLANRDNKKYQFIRNP
NIKQLAQDPIPINYVPSAPEKRPFKH


>TTHERM_00431250(gene)
ATTATCTTAAAAAAACACTAAAAAAACTTTTAGTTATTTATCAGAGTTGTTAGCAAACAA
ATTTTTATTTTAGCAAGAAAATCATTTTTGATTGAAATAAAAATGAGCGAGGATGAATCT
GATGGATTAAATTTCGATGAAGATGAAAACTCCCCCAAATTTAAGCCATAAGCTTCTATT
GAACAAGATGATAAACCTGAATTTTTGTCATAACCTTCAGATAGTGAAAGCAATTAAAAC
ATAAAATCAAATAATTAAAAAGTGAATAAATAGCAAAAAAGTGCATCAAAAGCAAATAAA
TTCTCTGATGATGATGATGCAGAACTTTCTGATATATTCGATAGTGACGATGATGATGAT
AGCAATAAGAAACCATAAAAATAGAAGCAAATTCATAAAGATAAATAAAATGATGTTAAA
AAAATCTAAGAACGTAAGACAATGTAGTAAGTAAGAGAAAGGCATGACAATAGTGGAGAA
AAAAAAAGATCAACTATGTAGTAAAGAAATTAGAATTCAGCAACAAAAAAATAATAAAAA
ACTAGCAGCAATAATAGCAATTATCAAAGTAATAAAAAAAGTGAAGGCCCTTCTTCTGCA
CCTTAAAATGTTGTTATTGATAAAGTAACTAATTAGAGAGTAACAGAGCAATAAAAAACT
ATTCAATCAGGATATGAAAAGAAGGAAGCGCTAACTGTTCTCACTCGTTCAGTTCTTGAA
ACTGCGGAATTACGTAACTTTCATAACTGGATTAAGAGTGTGATTATTAAGAAGTATTCT
GATGATATGAAGCAAATTATTAAAAAAAAAGAAGATCTCCGTACAGAAACAGGTTAGCTT
TTCGTCATGGAAATTGCATGTGGTTAGGGTGGTGATTTGAAGAAATGGCTTCATGCTGAT
ATAGGCTTGTATGTGGGTGTTGATATTTCTTTTAATTCTTTAAAAGAAGCTTCTCGTAGA
ACTAAAGATATTATGGAAAAGTTACCTCCACACTGGAATTACAAAAAATTTAAGTATGGA
TTTTACTAAAAAGATGGTTCAGCATCTACTGATGAGTTTTGGAAACACATTCACGATAAA
GATAAAGATTAAGATAAATCCAAGAGGTTTTTCTTTGATATAGTAAGTTGCCAGATGGCT
ATGCATTACATGTTTGGCAGTGAACAGCATGCTAGAAACTTCTTTTCTAATGCCACTTAG
AGACTAAATGACTAAGGCTATCTGCTTGTTACTTGCTCTGATTCAAATGCAATTGTAAAA
AAAATGCGTTCTAGAGGTAAGCTTGACTCTACTAACAACAAATATACCTTTGGAAACAAA
TACTTCTCTATGGCATTTGAGAATTTGAATTTTCCTGTCGGAAAACCTTACGGTTTAAAA
TATGAATTTTATCTACAAGATGCAGTTGGTGAAAAAGATGAAGCAACTGGATAAATTAAA
TACACTCCTGAATACCTTGTTGAATTGAATAATCTTAACAAATTAGCTATGGAATATTCA
TTAGTTGTTAAAGAAAACCTTAACTTCATAGAATTCTATAAAAATTACAGAAATAAATAC
GGATACCTTTTTAAATCTATGGGTTTGGATAAGTTTACTAATGATCATCCTTCAATCGAT
CCAGAGCTTTGGGAAATCTCTCACTGCTATAGAGTAATCGTTTTCTAAAAGGTAGATCTT
GCTAACAGAGATAATAAGAAATACTAATTTATACGTAATCCTAACATCAAATAGCTAGCA
TAAGATCCTATACCAATAAATTATGTACCCTCAGCACCTGAAAAACGTCCTTTCAAACAC
TGA