Identifiers and Description

Gene Model Identifier

TTHERM_00590090

Standard Name

CMB1 (CalModulin-Binding )

Aliases

PreTt24124 | 81.m00181 | 3726.m00057

Description

Calmodulin-binding protein; roles in cytokinesis and phagocytosis; localizes to division furrow, oral apparatus, and crescent-shaped structure; binds G-actin but not F-actin; localization and protein modifications disrupted in mutant cdaA1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00882 ) Zinc dependent phospholipase C
  • ( PF00015 ) methyl-accepting chemotaxis protein signaling domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 89.1%

TetraMine Data

TTHERM_00590090

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16953.19.997093137033517e-262hypothetical protein (515 aa)

General Information

Paragraph NoGene NameParagraph Text
11CMB1A recessive gene determining temperature-sensitive fission arrest was described in 1976 under the name "mo1". Around 1979, following the (then) new nomenclatural rules, it was re-named cdaA1 (CDA="cell division arrest"). In the early 1980's, Y. Watanabe and his associates made some remarkable findings reported in 1986. Using 2D-gel electrophoresis, they found a protein, which they called p85 (later renamed Cmb1p), which was localized to the oral apparatus and also to an apical filament ring and to structures (which turned out to be basal-body couplets) located just posterior to the division furrow. The equatorial localization was observed in cdaA1 homozygotes at the permissive temperature (when division took place), but not after a shift to the restrictive temperature (when the division furrow failed to develop). Based on these studies it was naturally assumed that p85 was the protein product of the cdaA gene, especially as p85 differed slightly in mobility in 2D-gels made from wild-type and cdaA1 cell extracts. However, in 1999 the gene encoding p85 was cloned. This yielded a big surprise: "The cdaA1 p85 cDNA contained one open reading frame and its deduced amino acid sequence, cdaA1 p85, was completely identical to that of wild-type p85" (p. 116). There were some differences in the 3'UTR and 5' UTRs, but they "do not affect the transcription and translation of the p85 gene, because the amounts of transcribed mRNA and translated protein of cdaA1 p85 were equivalent to those of wild type p85" (p. 118). The authors conclude the Results section as follows: "Thus, we suppose that the difference in molecular weight between cdaA1 and wild-type p85 was caused by a disorder of post-translational modification mechanisms of p85 in cdaA1 cells." (p. 116). These results demonstrate that p85 is likely not the product of the cdaA1 gene, and that the gene mutated in the cdaA1 strain is more likely to be a protein responsible for the post-translational modification of p85, which is altered in the cdaA1 mutant. (Contributed by J. Frankel, University of Iowa, 2005)

Associated Literature

  1. Ref:11944929: Gonda K, Numata O (2002) p85 binds to G-actin in a Ca(2+)/calmodulin-dependent manner, thus regulating the initiation of cytokinesis in tetrahymena. Biochemical and biophysical research communications 292(4):1098-103
  2. Ref:11942614: Numata O, Gonda K (2001) Determination of division plane and organization of contractile ring in Tetrahymena. Cell structure and function 26(6):593-601
  3. Ref:11129794: Gonda K, Komatsu M, Numata O (2000) Calmodulin and Ca2+/calmodulin-binding proteins are involved in Tetrahymena thermophila phagocytosis. Cell structure and function 25(4):243-51
  4. Ref:10816251: Numata O, Gonda K, Watanabe A, Kurasawa Y (2000) Cytokinesis in Tetrahymena: determination of division plane and organization of contractile ring. Microscopy research and technique 49(2):127-35
  5. Ref:10527850: Gonda K, Nishibori K, Ohba H, Watanabe A, Numata O (1999) Molecular cloning of the gene for p85 that regulates the initiation of cytokinesis in Tetrahymena. Biochemical and biophysical research communications 264(1):112-8
  6. Ref:10772759: Numata O, Fujiu K, Gonda K (1999) Macronuclear division and cytokinesis in Tetrahymena. Cell biology international 23(12):849-57
  7. Ref:10523498: Gonda K, Katoh M, Hanyu K, Watanabe Y, Numata O (1999) Ca(2+)/calmodulin and p85 cooperatively regulate an initiation of cytokinesis in Tetrahymena. Journal of cell science 112 ( Pt 21)( ):3619-26
  8. Ref:7795488: Numata O, Suzuki H, Ohba H, Watanabe Y (1995) The mutant gene product of a Tetrahymena cell-division-arrest mutant cdaA is localized in the accessory structure of specialized basal body close to the division furrow. Zoological science 12(1):133-5
  9. Ref:3536899: Ohba H, Ohmori I, Numata O, Watanabe Y (1986) Purification and immunofluorescence localization of the mutant gene product of a Tetrahymena cdaA1 mutant affecting cell division. Journal of biochemistry 100(3):797-808

Sequences

>TTHERM_00590090(coding)
ATGAGATCCTCAACCTTATCGATCTTGCTTTTATGCATTTTGGGAGCTTCCATCGCTCAA
AATCTTAATGACGCCAATTAAGATATTCTTTAATAAGTTATCAATGGTTTCTACGAATAA
AATAAGTTAGCTGACCCCAGTACTATCGTTCCCTGCATTGATTCTACTACTGCTGCCAAT
ATTGTTGCTTTAGTACCTTAAGTCTTAAAGAAGGCCTCAAGCATTCTTACTATCGCTTAA
GTCCCCGCTTTAGTCGAAAATTTCGTCAAAACTTTGAACCCTGCTGTTGGTGAATGCCTC
AAGGATAACAAAGAAGTTGCTGAACTCGCCACTGTCTTTGATGTCTCTAAAATTACCTAA
CAAGCTGCTATTAACTGGGCTACTGGTCACGCTAGTACCGTTACTGGTGAAGCTTCCACC
CTCAACAAGTTATGGTCCGGTGCTTAATATAACTAATTTGGTAATAACGCCTCCAGTTTC
GCTCATACTGTTATTGACTAAATCTCTGGTAAATCAGTTTCTGAATCTAACGATGCTAAC
CAAGATATTATCTAACAAGTCATTAACGGATTCTATGAATAAAATAAGTTAGCTGACCCC
ACCACTATTGTTCCCTGCATTGATACTACTACTGCTGCCAATATCGTAGCTTTAGTACCT
TAAGTCTTAAAGAAGGCCTCAAGCATTCTTACTATTGCTTAAGTCGCCACTTTAGTCGAA
AATTTCGTCAAAACTTTGAACCCTGCTGTTGGTGAATGCCTCAAGGATAACAAAGAAGTT
GCTGAACTCGCCACTGTCTTTGATGTCTCTAAAATTACCTAACAAGCTGCTATTAACTGG
GCTACTGGTCACGCTAGTACCGTTACTGGTGAAGCTACCACCCTCAACAAGTTATGGTCT
AGTGCTTAATACAACTAATTAGGAAACAACGCTTCCAGCTTTGCTCATACTGTTATTAAC
CAAATCTCTGGTAACTCAGTTTCTGAATCTAACGATGCTAACCAAGATATTATCTAACAA
GTCATTAACGGATTCTATGAATAAAATAAGTTAGCTGACCCCACCACTATTGTTCCCTGC
ATTGATACTACTACTGCTGCCAATATCGTAGCTTTAGTACCTTAAGTCTTAAAGAAGGCC
TCAAGCATTCTTACTATCGCTTAAGTCGCCACTTTAGTCGAAAATTTCGTCAAAACTTTG
AACCCTGCTGTTGGTGAATGCCTCAAGGATAATAAAGAAGTTGCTGAACTCGCCACTGTC
TTTGATGTCTCTAAAATTACCTAACAAGCTGCTATTAACTGGGCTACTGGTCACGCTAGT
ACCGTTACTGGTGAAGCTACCACCCTCAACAAGTTATGGTCCAGTGCTTAATACAACTAA
TTAGGAAACAACGCTTCCAGCTTTGCTCATACTGTCATTAACCAAATCTCTGGTAATGCT
AATGACATCAATGCTACCAATCAATAAATCTTACAAGATTTCTACAATGGTCTCTACTAA
CAATAAGGTTTACCCAACCCTACCTTTACCGTCTGCTACCCTGATGCTGCTGCTGCTGAC
TTCGTCAATTTCGCTCCTGGCTTCTTGAAGAAGGGTTCATCTATTCTTACTATTAATGCT
GCCTTCACTGATTTACAAAAGTTCACTGAAGACTAAGCTGCTAAGTATCCTTAAATCGGT
GAATGCTCAAAGAACTACGCTTCTGAATTACAAGCTTTATCTGATGCTTTGGGAGTTAAG
AATCCTGCTACAGTTTAAGATACTATCAAGAATTACATTACTGCTAACCTTTCTTCCACC
ACTAAGGCTTTCGGTGATGCTAACAACTCCTGGAAGGGATCTAACTACGTTTAATCTGGT
AAATAAGTTTCTGCTTGGGTTAAGTTGGCTCTTGCTAAAAACTAAATGACTGAAGAAGAA
GTTAATGCTACTAACTAATAAATCTTACAAGATTTCTACAACGGTCTCTACTAACAATAA
GGTTTACCCAACCCTACCTTCGTTACCGTCTGCTACCCTGATGCTGCTGCTGCTGACTTC
GTCAATTTCGCTCCTGGCTTCTTGAAGAAGGGTTCATCTATCCTTACTATTAATGCTGCC
TTCACTGATTTACAAAAGTTCACTGAAGACTAAGCTGCTAAGTATCCTTAAATCGGTGAA
TGCTCAAAGAACTACGCTTCTGAATTACAAGCTTTATCTGATGCTTTGGGTGTTAAGAAT
CCTGCTACAGTTTAAGATACTATCAAGAATTACATTACTGCTAACCTTTCTTCCACCACT
AAGGCTTTCGGTGATGCTAATAACTCCTGGAAGGGATCTAACTACGTTTAATCTGGTAAA
TAAGTTTCTGCTTGGGTTAAGTTGGCTCTTGCTAAGAACGCTTTTAGCGAAGATTAATAA
ATAATGTTTTGA


>TTHERM_00590090(protein)
MRSSTLSILLLCILGASIAQNLNDANQDILQQVINGFYEQNKLADPSTIVPCIDSTTAAN
IVALVPQVLKKASSILTIAQVPALVENFVKTLNPAVGECLKDNKEVAELATVFDVSKITQ
QAAINWATGHASTVTGEASTLNKLWSGAQYNQFGNNASSFAHTVIDQISGKSVSESNDAN
QDIIQQVINGFYEQNKLADPTTIVPCIDTTTAANIVALVPQVLKKASSILTIAQVATLVE
NFVKTLNPAVGECLKDNKEVAELATVFDVSKITQQAAINWATGHASTVTGEATTLNKLWS
SAQYNQLGNNASSFAHTVINQISGNSVSESNDANQDIIQQVINGFYEQNKLADPTTIVPC
IDTTTAANIVALVPQVLKKASSILTIAQVATLVENFVKTLNPAVGECLKDNKEVAELATV
FDVSKITQQAAINWATGHASTVTGEATTLNKLWSSAQYNQLGNNASSFAHTVINQISGNA
NDINATNQQILQDFYNGLYQQQGLPNPTFTVCYPDAAAADFVNFAPGFLKKGSSILTINA
AFTDLQKFTEDQAAKYPQIGECSKNYASELQALSDALGVKNPATVQDTIKNYITANLSST
TKAFGDANNSWKGSNYVQSGKQVSAWVKLALAKNQMTEEEVNATNQQILQDFYNGLYQQQ
GLPNPTFVTVCYPDAAAADFVNFAPGFLKKGSSILTINAAFTDLQKFTEDQAAKYPQIGE
CSKNYASELQALSDALGVKNPATVQDTIKNYITANLSSTTKAFGDANNSWKGSNYVQSGK
QVSAWVKLALAKNAFSEDQQIMF


>TTHERM_00590090(gene)
ATGAGATCCTCAACCTTATCGATCTTGCTTTTATGCATTTTGGGAGCTTCCATCGCTCAA
AATCTTAATGACGCCAATTAAGATATTCTTTAATAAGTTATCAATGGTTTCTACGAATAA
AATAAGTTAGCTGACCCCAGTACTATCGTTCCCTGCATTGATTCTACTACTGCTGCCAAT
ATTGTTGCTTTAGTACCTTAAGTCTTAAAGAAGGCCTCAAGCATTCTTACTATCGCTTAA
GTCCCCGCTTTAGTCGAAAATTTCGTCAAAACTTTGAACCCTGCTGTTGGTGAATGCCTC
AAGGATAACAAAGAAGTTGCTGAACTCGCCACTGTCTTTGATGTCTCTAAAATTACCTAA
CAAGCTGCTATTAACTGGGCTACTGGTCACGCTAGTACCGTTACTGGTGAAGCTTCCACC
CTCAACAAGTTATGGTCCGGTGCTTAATATAACTAATTTGGTAATAACGCCTCCAGTTTC
GCTCATACTGTTATTGACTAAATCTCTGGTAAATCAGTTTCTGAATCTAACGATGCTAAC
CAAGATATTATCTAACAAGTCATTAACGGATTCTATGAATAAAATAAGTTAGCTGACCCC
ACCACTATTGTTCCCTGCATTGATACTACTACTGCTGCCAATATCGTAGCTTTAGTACCT
TAAGTCTTAAAGAAGGCCTCAAGCATTCTTACTATTGCTTAAGTCGCCACTTTAGTCGAA
AATTTCGTCAAAACTTTGAACCCTGCTGTTGGTGAATGCCTCAAGGATAACAAAGAAGTT
GCTGAACTCGCCACTGTCTTTGATGTCTCTAAAATTACCTAACAAGCTGCTATTAACTGG
GCTACTGGTCACGCTAGTACCGTTACTGGTGAAGCTACCACCCTCAACAAGTTATGGTCT
AGTGCTTAATACAACTAATTAGGAAACAACGCTTCCAGCTTTGCTCATACTGTTATTAAC
CAAATCTCTGGTAACTCAGTTTCTGAATCTAACGATGCTAACCAAGATATTATCTAACAA
GTCATTAACGGATTCTATGAATAAAATAAGTTAGCTGACCCCACCACTATTGTTCCCTGC
ATTGATACTACTACTGCTGCCAATATCGTAGCTTTAGTACCTTAAGTCTTAAAGAAGGCC
TCAAGCATTCTTACTATCGCTTAAGTCGCCACTTTAGTCGAAAATTTCGTCAAAACTTTG
AACCCTGCTGTTGGTGAATGCCTCAAGGATAATAAAGAAGTTGCTGAACTCGCCACTGTC
TTTGATGTCTCTAAAATTACCTAACAAGCTGCTATTAACTGGGCTACTGGTCACGCTAGT
ACCGTTACTGGTGAAGCTACCACCCTCAACAAGTTATGGTCCAGTGCTTAATACAACTAA
TTAGGAAACAACGCTTCCAGCTTTGCTCATACTGTCATTAACCAAATCTCTGGTAATGCT
AATGACATCAATGCTACCAATCAATAAATCTTACAAGATTTCTACAATGGTCTCTACTAA
CAATAAGGTTTACCCAACCCTACCTTTACCGTCTGCTACCCTGATGCTGCTGCTGCTGAC
TTCGTCAATTTCGCTCCTGGCTTCTTGAAGAAGGGTTCATCTATTCTTACTATTAATGCT
GCCTTCACTGATTTACAAAAGTTCACTGAAGACTAAGCTGCTAAGTATCCTTAAATCGGT
GAATGCTCAAAGAACTACGCTTCTGAATTACAAGCTTTATCTGATGCTTTGGGAGTTAAG
AATCCTGCTACAGTTTAAGATACTATCAAGAATTACATTACTGCTAACCTTTCTTCCACC
ACTAAGGCTTTCGGTGATGCTAACAACTCCTGGAAGGGATCTAACTACGTTTAATCTGGT
AAATAAGTTTCTGCTTGGGTTAAGTTGGCTCTTGCTAAAAACTAAATGACTGAAGAAGAA
GTTAATGCTACTAACTAATAAATCTTACAAGATTTCTACAACGGTCTCTACTAACAATAA
GGTTTACCCAACCCTACCTTCGTTACCGTCTGCTACCCTGATGCTGCTGCTGCTGACTTC
GTCAATTTCGCTCCTGGCTTCTTGAAGAAGGGTTCATCTATCCTTACTATTAATGCTGCC
TTCACTGATTTACAAAAGTTCACTGAAGACTAAGCTGCTAAGTATCCTTAAATCGGTGAA
TGCTCAAAGAACTACGCTTCTGAATTACAAGCTTTATCTGATGCTTTGGGTGTTAAGAAT
CCTGCTACAGTTTAAGATACTATCAAGAATTACATTACTGCTAACCTTTCTTCCACCACT
AAGGCTTTCGGTGATGCTAATAACTCCTGGAAGGGATCTAACTACGTTTAATCTGGTAAA
TAAGTTTCTGCTTGGGTTAAGTTGGCTCTTGCTAAGAACGCTTTTAGCGAAGATTAATAA
ATAATGTTTTGA