Identifiers and Description

Gene Model Identifier

TTHERM_00590200

Standard Name

CLP1 (pre-mRNA cleavage complex II protein Clp1)

Aliases

PreTt24135 | 81.m00192 | 3726.m00068

Description

pre-mRNA cleavage complex II protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00590200

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16966.19.997093137033517e-262hypothetical protein (505 aa)
OxytrichaContig11030.0.g714.000437458487249e-40Molybdopterin guanine dinucleo
tide synthesis protein B
WormBaseWBGene000103043.999970367130025e-21locus:clpf-1 Protein clpf-1
status:Confirmed UniProt:P
52874 protein_id:CAA84329.1
DictyBaseDDB_G02855072.000769134519826e-18clp1 on chromosome: 4 position
3327387 to 3328942
SGDYOR250C0.00000000030007160092483236CLP1 Subunit of cleavage facto
r I (CFI), involved in both th
e endonucleolyitc cleavage and
polyadenylation steps of mRNA
3-end maturation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00590200(coding)
ATGATGGAAGAATAGTTCATATGCGATGAAAAAAAGTTTATTAGATAGGAGGTAGAAAAA
ATGAGGGAATTTTCATTTAACATAAATAATGAAGATGGTTTAAAACTCTTTCTGAAAGAG
GGTACTGCTGAAATCTTCGGTAGAGAATTACCACAATATACAATTTAATAATTTTAAAAG
GGAGATCGTTTTTCAATATTTACATGGACAGGCTGTGTACTCTATTTAGAATATATGAGT
CATTCTGACTTCTTTTAGTCTACAGATGAGTCACAGTATCCCATATATGCAAACATAAAT
TAATATTTACACGAAATGAGATCATAAGCATAAGATTAGCGTAAAATAGGCCCTAAAATT
TTAATATGTGGACCAAACTAAAGTGGAAAAACAACTGTTTCAAAGACACTGACTAACTAT
TGCTGTAAGCTGGGATGGACTCCTATTTTAGTTGATTTAGACCCTATGCTTAATACAGTG
ATGGCAGGAGGATGTATTGGAGCTTGTGTCTGCAAAGACTCTTATCCTACAAATGGAATA
GAAATTAAAAATAAAATTATATTCTTTCATGGATACAGTCGCATTCAATTAGGCCTTCTT
AAGAATTAGATAGAAGTCTTAGGAAACACAGTTCAAAAAAAGCTCTAAAATAACTTAGAA
TAATTCCTTAAAAAGCATAACTTGCAAACTGCTCCAGATGCAGAAGGAGCCTAACAGAAG
ACCAACAAATAAAAATATCCATCGTAATAAAATATTTAAAACTCAACTGCATAGATTAAA
CTACCATCAGGTGTCAACATAAATTAAATGCTGTTACTCCCTTAAGACAAGCAAATGTTT
TCAAGTGGATGCATAATTAATATGCCTCCTCTCTAATCTAGAGAATAGAAAGAAGTTATT
GACCTTATCATAAAACATTTTCAAGTTGATGTGATAATTGGTCTAGACGATTAAGTATTT
AATTCTTTAAAGCAAAACTAGCTTTTGACTAATGGATATAGTGTTATACGTACCACAAAA
CCTTCAGGATTAAAAACTAAAGAAGAGTCAGAGCTAGTTGAGGAAGCTAGAAAAATAAAT
TAAAAGCTCTTTTAATAGTACTTTAAAGGACTTAATAATGACATTGATTGTCATAATTAA
GAAGTTAACTTAAATGATTTACTTGTTTATAGATTAAAAATAAATGAAAAAAATAGCTTA
GCAAATACTTCAATGTAATAATAAAAGCAAATTTATGAAAGAGTTGATCTTTCCAAAGAA
AATGTGACAAAGAGTATAGTTGGCGTACTAAACCTTACAAGATCCTCTGTTGAAAAATTA
AAAGAAGAAGAAATATTTGAAAAAATATCTAAAAGTACTCTCAGTCTTTTGGTTCATTTA
TCAGATATGAGAACAAACCAGCCCTATGTACGTTTGTTTTTACCTGGGCTAAATATGGAA
AATATAATTAAAGAAAATGTATGTGTAATAGGAGACATAACATGGTTTGAATCATCAAGT
GATAAAAAAAAATGA


>TTHERM_00590200(protein)
MMEEQFICDEKKFIRQEVEKMREFSFNINNEDGLKLFLKEGTAEIFGRELPQYTIQQFQK
GDRFSIFTWTGCVLYLEYMSHSDFFQSTDESQYPIYANINQYLHEMRSQAQDQRKIGPKI
LICGPNQSGKTTVSKTLTNYCCKLGWTPILVDLDPMLNTVMAGGCIGACVCKDSYPTNGI
EIKNKIIFFHGYSRIQLGLLKNQIEVLGNTVQKKLQNNLEQFLKKHNLQTAPDAEGAQQK
TNKQKYPSQQNIQNSTAQIKLPSGVNINQMLLLPQDKQMFSSGCIINMPPLQSREQKEVI
DLIIKHFQVDVIIGLDDQVFNSLKQNQLLTNGYSVIRTTKPSGLKTKEESELVEEARKIN
QKLFQQYFKGLNNDIDCHNQEVNLNDLLVYRLKINEKNSLANTSMQQQKQIYERVDLSKE
NVTKSIVGVLNLTRSSVEKLKEEEIFEKISKSTLSLLVHLSDMRTNQPYVRLFLPGLNME
NIIKENVCVIGDITWFESSSDKKK


>TTHERM_00590200(gene)
ATGATGGAAGAATAGTTCATATGCGATGAAAAAAAGTTTATTAGATAGGAGGTAGAAAAA
ATGAGGGAATTTTCATTTAACATAAATAATGAAGATGGTTTAAAACTCTTTCTGAAAGAG
GGTACTGCTGAAATCTTCGGTAGAGAATTACCACAATATACAATTTAATAATTTTAAAAG
GGAGATCGTTTTTCAATATTTACATGGACAGGCTGTGTACTCTATTTAGAATATATGAGT
CATTCTGACTTCTTTTAGTCTACAGATGAGTCACAGTATCCCATATATGCAAACATAAAT
TAATATTTACACGAAATGAGATCATAAGCATAAGATTAGCGTAAAATAGGCCCTAAAATT
TTAATATGTGGACCAAACTAAAGTGGAAAAACAACTGTAAGTACTTCTTATTGATTTTCA
TTCAGTGATTGAATACTTAATATTTTAGTTAGAGCAAATTATATTATAAATGAAGATAAA
TTTGAGTAAATCTTTCGCTTGCATAGCAGCGAGAGAGTATTAAATTCATTTATTTTTGTT
ATAATTATTAGGTTTCAAAGACACTGACTAACTATTGCTGTAAGCTGGGATGGACTCCTA
TTTTAGTTGATTTAGACCCTATGCTTAATACAGTGATGGCAGGAGGATGTATTGGAGCTT
GTGTCTGCAAAGACTCTTATCCTACAAATGGAATAGAAATTAAAAATAAAATTATATTCT
TTCATGGATACAGTCGCATTCAATTAGGCCTTCTTAAGAATTAGATAGAAGTCTTAGGAA
ACACAGTTCAAAAAAAGCTCTAAAATAACTTAGAATAATTCCTTAAAAAGCATAACTTGC
AAACTGCTCCAGATGCAGAAGGAGCCTAACAGAAGACCAACAAATAAAAATATCCATCGT
AATAAAATATTTAAAACTCAACTGCATAGATTAAACTACCATCAGGTGTCAACATAAATT
AAATGCTGTTACTCCCTTAAGACAAGCAAATGTTTTCAAGTGGATGCATAATTAATATGC
CTCCTCTCTAATCTAGAGAATAGAAAGAAGTTATTGACCTTATCATAAAACATTTTCAAG
TTGATGTGATAATTGGTCTAGACGATTAAGTATTTAATTCTTTAAAGCAAAACTAGCTTT
TGACTAATGGATATAGTGTTATACGTACCACAAAACCTTCAGGATTAAAAACTAAAGAAG
AGTCAGAGCTAGTTGAGGAAGCTAGAAAAATAAATTAAAAGCTCTTTTAATAGTACTTTA
AAGGACTTAATAATGACATTGAGTATTTTTTTTTTCATTCATTCATTTTTTCTTTAAAAA
TTTTTAAGCTAAATCAAAATAAATTCATCATAAAAGTCTTTCAATTTATAAATTTTCTAA
CAATTTAATCTTTATGAAATGCTAATTTTAAGTCTCCTAATAAGATTACTAAAATAATTT
TATGAATAAGCAATAAATAAACTTCATACATAAAAATATTTAATTAATTAAATTCTAAAA
AATTAGGTTTTTTATATAAATTGCTTATATTTTTAATTAAGCAAAAGATTTATTTAAATA
TTTAATTATGTTTGAATAAACTCTTATATTTGCTTCAATTTAAGATGATTTTATTTTTGA
TATTTCAATTTCCAAATAAATTTAACGATTTTTAAGATATTTTAATAAAATTTTTATATT
ATAAAATAGTTGTCATAATTAAGAAGTTAACTTAAATGATTTACTTGTTTATAGATTAAA
AATAAATGAAAAAAATAGCTTAGCAAATACTTCAATGTAATAATAAAAGCAAATTTATGA
AAGAGTTGATCTTTCCAAAGAAAATGTGACAAAGAGTATAGTTGGCGTACTAAACCTTAC
AAGATCCTCTGTTGAAAAATTAAAAGAAGAAGAAATATTTGAAAAAATATCTAAAAGTAC
TCTCAGTCTTTTGGTTCATTTATCAGATATGAGAACAAACCAGCCCTATGTACGTTTGTT
TTTACCTGGGCTAAATATGGAAAATATAATTAAAGAAAATGTATGTGTAATAGGAGACAT
AACATGGTTTGAATCATCAAGTGATAAAAAAAAATGA