Identifiers and Description

Gene Model Identifier

TTHERM_00049070

Standard Name

CIT2 (CITrate synthase )

Aliases

PreTt11286 | 3.m01954 | 3824.m03044

Description

Putative citrate synthase; putative peroxisomal targeting signal peptide; possible product of a recent horizontal gene transfer event

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

  • transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer (IEA) | GO:0046912

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00049070

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_29760
Tetrahymena borealisEI9_01650.19.997093137033517e-262citrate synthase I family prot
ein (481 aa)
DictyBaseDDB_G02674269.997093137033517e-262cshA on chromosome: 1 position
1569279 to 1571100
OxytrichaContig22606.0.g419.997093137033517e-262Citrate synthase
SGDYCR005C7.996806159126539e-24CIT2 Citrate synthase, catalyz
es the condensation of acetyl
coenzyme A and oxaloacetate to
form citrate, peroxisomal iso
zyme involved in glyoxylate cy
cle; expression is controlled
by Rtg1p and Rtg2p transcripti
on factors
WormBaseWBGene000008331.0002869940498747e-21locus:cts-1 Probable citrate
synthase, mitochondrial sta
tus:Confirmed UniProt:P34575
protein_id:CAA83004.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15170257: Mukai A, Endoh H (2004) Presence of a bacterial-like citrate synthase gene in Tetrahymena thermophila: recent lateral gene transfers (LGT) or multiple gene losses subsequent to a single ancient LGT? Journal of molecular evolution 58(5):540-9
  2. Ref:12025402: Kojima H, Numata O (2002) Enzymatic form and cytoskeletal form of bifunctional Tetrahymena 49kDa protein is regulated by phosphorylation. Zoological science 19(1):37-42
  3. Ref:11260259: Takeda T, Yoshihama I, Numata O (2001) Identification of Tetrahymena hsp60 as a 14-nm filament protein/citrate synthase-binding protein and its possible involvement in the oral apparatus formation. Genes to cells : devoted to molecular & cellular mechanisms 6(2):139-49
  4. Ref:9268687: Takeda T, Watanabe Y, Numata O (1997) Direct demonstration of the bifunctional property of Tetrahymena 14-nm filament protein/citrate synthase following expression of the gene in Escherichia coli. Biochemical and biophysical research communications 237(2):205-10
  5. Ref:9443816: Kojima H, Watanabe Y, Numata O (1997) The dual functions of Tetrahymena citrate synthase are due to the polymorphism of its isoforms. Journal of biochemistry 122(5):998-1003
  6. Ref:8575889: Numata O (1996) Multifunctional proteins in Tetrahymena: 14-nm filament protein/citrate synthase and translation elongation factor-1 alpha. International review of cytology 164( ):1-35
  7. Ref:8537311: Kojima H, Chiba J, Watanabe Y, Numata O (1995) Citrate synthase purified from Tetrahymena mitochondria is identical with Tetrahymena 14-nm filament protein. Journal of biochemistry 118(1):189-95
  8. Ref:7592552: Takeda T, Kurasawa Y, Watanabe Y, Numata O (1995) Polymerization of highly purified Tetrahymena 14-nm filament protein/citrate synthase into filaments and its possible role in regulation of enzymatic activity. Journal of biochemistry 117(4):869-74
  9. Ref:7737352: Numata O, Yasuda T, Watanabe Y (1995) Tetrahymena intramitochondrial filamentous inclusions contain 14-nm filament protein/citrate synthase. Experimental cell research 218(1):123-31
  10. Ref:8108567: Numata O (1994) [Multifunctional proteins in Tetrahymena--14 nm filament protein and EF-1 alpha]. Tanpakushitsu kakusan koso. Protein, nucleic acid, enzyme 39(2):106-18
  11. Ref:1385189: Kurasawa Y, Numata O, Katoh M, Hirano H, Chiba J, Watanabe Y (1992) Identification of Tetrahymena 14-nm filament-associated protein as elongation factor 1 alpha. Experimental cell research 203(1):251-8
  12. Ref:1993043: Numata O, Takemasa T, Takagi I, Hirono M, Hirano H, Chiba J, Watanabe Y (1991) Tetrahymena 14-nm filament-forming protein has citrate synthase activity. Biochemical and biophysical research communications 174(2):1028-34
  13. Ref:6401983: Fabregat I, Satrústegui J, Machado A (1983) Citrate synthase of Tetrahymena pyriformis: evolutionary and regulatory aspects. Archives of biochemistry and biophysics 220(2):354-60

Sequences

>TTHERM_00049070(coding)
ATGGAAAGAATTACTGATCTCAATTAATAAATTATCACTAACGAAACTGGTGAAAAGGAA
TACTACACAGTCACAGATAATAGAAATGGCAAAACTTATGAAGTTCCTATCAGAAACTCT
AGAGAAGGAAGATATATAATGGCTAAGGATATTGGTAAAATTAAAGATGCTGAAGGAAAT
GTCCTCCGTGTCTACGATCCTGGTTATATGAACACTATTGTTAATACTTCCAGAATTTGC
TATATTGATGGTGACTTGGGTGTATTAGAGTATAGAGGTATTCCAATTGAGTAGCTTGCT
GAGAAATCTACTTTCTTGGAAGTAGCTTATCTTCTTATCTACGGAGAATTACCAACCAAG
ACCCAATTTGAAGAATTCAACTAAAGAATTTCAGGTCACACATTCTTGCATACTGATGTC
TTACAAATGATGAAACACTTCAGATATGATGCTCATCCTATGGGTATGCTTATTAGCACT
ATTGCAGCATTATCTACTTTCCGTCCTGGTTCCAACCCTGCCTTAGCTGGTTAAGATATC
TATAAGGACTTGAAGATTCGTAACAAATAAATTTATCGTATTCTTGGACAAGTTCCTACT
ATTGCTGCTAACGCTTATAGATCTCGTATTGGTAGAAACTTCAACAACCCATCTTCTGAT
CTTCCTTACGTTGATAACTTCCTTTACATGATGGATAAATTAAATGAAAATAAATACAAG
CCTCATCCTAAGTTAGCTAAGGCTTTGGATATTCTCTTTATTCTCCATGCTGAACACGAA
ATGAATTGCTCAACAGCATTTGTTAGACATTTAGCTTCTTCTGGTGTTGATGTATACTCT
TGCATAGCTGGTTCTGCTGCTGCTCTTTATGGTCCTAAGCATGGTGGTGCAAATGAAGCC
GTTTTAAGAATGCTTGAATAAATTGGTGATGTTAAGAATATTCCCTCTTTCATTGATAAG
GTCAAGAATAGAAAGGCTTTACTTTTCGGTTTTGGTCACAGAGTCTATAAGAACTACGAC
CCTCGTGCTAAAATCGTCAAGAAGACTGCTTATGAAGTTTTTGAAATCTGTGGAAAAGAA
CCTTTAATTGAAATTGCCATCGAATTGGAAAAGATAGCTCTTGAAGATGAATTTTTCATT
AAGAGAAAGTTATATCCAAATGTTGATTTCTACTCTGGTGTTATTTATAGAGCTATGGGT
TTCCCCACTGATATGTTCCCAGTCCTTTTCACTATTCCAAGAGTTGCTGGTTGGTTAGCT
CATTGGGTTGAATACCTCGATGATAAGGAAAACAACATTGTTAGACCCAGACAAAACTAT
GTTGGCTATGCTAAAAGAGATTATGTTCCTATGGAATAAAGACAAGAAGCTAAATTTAAC
TTAGAAAGCTCCAAGAGTTCTACTTCCAAGAGAAGAGAAGCTGGTACAAGCGTTGTTTTG
TGA


>TTHERM_00049070(protein)
MERITDLNQQIITNETGEKEYYTVTDNRNGKTYEVPIRNSREGRYIMAKDIGKIKDAEGN
VLRVYDPGYMNTIVNTSRICYIDGDLGVLEYRGIPIEQLAEKSTFLEVAYLLIYGELPTK
TQFEEFNQRISGHTFLHTDVLQMMKHFRYDAHPMGMLISTIAALSTFRPGSNPALAGQDI
YKDLKIRNKQIYRILGQVPTIAANAYRSRIGRNFNNPSSDLPYVDNFLYMMDKLNENKYK
PHPKLAKALDILFILHAEHEMNCSTAFVRHLASSGVDVYSCIAGSAAALYGPKHGGANEA
VLRMLEQIGDVKNIPSFIDKVKNRKALLFGFGHRVYKNYDPRAKIVKKTAYEVFEICGKE
PLIEIAIELEKIALEDEFFIKRKLYPNVDFYSGVIYRAMGFPTDMFPVLFTIPRVAGWLA
HWVEYLDDKENNIVRPRQNYVGYAKRDYVPMEQRQEAKFNLESSKSSTSKRREAGTSVVL


>TTHERM_00049070(gene)
ATGGAAAGAATTACTGATCTCAATTAATAAATTATCACTAACGAAACTGGTGAAAAGGAA
TACTACACAGTCACAGATAATAGAAATGGTGCGTTATTTTTATTTAGTTTAGGCAGCAAT
CTCCTAATTTGTTGTTTTATTTTTTGTTTTCACTCTACTTATTTTAAACTAGAGATTTAT
TTTCTACTTATTCTCCTACCTACAGTCCAAAAAGAAATTTACTAGTCAGTTCAATAATAA
TCATTAACTTTTTAATTATAGGCAAAACTTATGAAGTTCCTATCAGAAACTCTAGAGAAG
GAAGATATATAATGGCTAAGGATATTGGTAAAATTAAAGATGCTGAAGGAAATGTCCTCC
GTGTCTACGATCCTGGTTATATGAACACTATTGTTAATGTAATTTATTTTATTTGTATTT
ATTTAAAGTTAATGTAAAACGATATCAAACTCTTAAGTCTTTATTTCTTATTTAAACAAA
TATTTTCTTATAGTCTGCTAAATAATATTATATTTTTTTAAACAGACTTCCAGAATTTGC
TATATTGATGGTGACTTGGGTGTATTAGAGTATAGAGGTATTCCAATTGAGTAGCTTGCT
GAGAAATCTACTTTCTTGGAAGTAGCTTATCTTCTTATCTACGGAGAATTACCAACCAAG
ACCCAATTTGAAGAATTCAACTAAAGGTATTTCATATTTCTATTTTTAAGATAAAACTCC
TCCTTTTAATAAATATCTCAAAAACGATTGATTCCACTGGTCTGATGAAAATGAGCAAAA
TTTAAAATTAAAGTGAAATTAAATGGCTGAAACAATAAAAATATTGGTTTTAGTTAGTTT
AGTAAAACATAATCATATGAAAAGTAAAATCAGAAGATGAAAAGGAATACATTTTTAAAC
TTTAAGAAAAAATGAATTTGAAAATTTTTCTTTCATTAATTATGTTTGAACTAGGAATAT
TTAAAGTTATCAATAAATTATTGATCATTTAATGATAATAATTATTGATCAATTTATTGA
TTGATTAATAAATAAATAAATAAATTATTTAATTATATATTGGAATAAAGCAATAATTTA
TTATTAATTTAAATAATTTTTTTTATTGTTGATCAGCTCATAAATACTAATCCTGACCAT
TTAAATCTTTTAAAATAAATCTAATAACATTTAAAACGGAAAAAAGAAACAATTTATTTT
TATTATAAAAAGAATTTCAGGTCACACATTCTTGCATACTGATGTCTTACAAATGATGAA
ACACTTCAGATATGATGCTCATCCTATGGGTATGCTTATTAGCACTATTGCAGCATTATC
TACTTTCCGTCCTGGTTCCAACCCTGCCTTAGCTGGTTAAGATATCTATAAGGACTTGAA
GATTCGTAACAAATAAATTTATCGTATTCTTGGACAAGTTCCTACTATTGCTGCTAACGC
TTATAGATCTCGTATTGGTAGAAACTTCAACAACCCATCTTCTGATCTTCCTTACGTTGA
TAACTTCCTTTACATGATGGATAAATTAAATGAAAATAAATACAAGCCTCATCCTAAGTT
AGCTAAGGCTTTGGATATTCTCTTTATTCTCCATGCTGAACACGAAATGAATTGCTCAAC
AGCATTTGTTAGGTAAATAAAAATTTAGATAATATAATTTAAAGTAATCATTTTATTATA
ATAAAAATTAGACATTTAGCTTCTTCTGGTGTTGATGTATACTCTTGCATAGCTGGTTCT
GCTGCTGCTCTTTATGGTACATAATTATTAGCATATTAAATTAGCTTTAAATAAATATAA
GATAGCTTAGCATAAAATTAAGTGCAGTTAATTTTAAATATAAATTTTTAAAATAGGTCC
TAAGCATGGTGGTGCAAATGAAGCCGTTTTAAGAATGCTTGAATAAATTGGTGATGTTAA
GAATATTCCCTCTTTCATTGATAAGGTCAAGAATAGAAAGGCTTTACTTTTCGGTTTTGG
TCACAGAGTCTATAAGAACTACGACCCTCGTGCTAAAATCGTCAAGAAGACTGCTTATGA
AGTTTTTGAAATCTGTGGAAAAGAACCTTTAATTGAAATTGCCATCGAATTGGAAAAGAT
AGCTCTTGAAGATGAATTTTTCATTAAGAGAAAGTTATATCCAAATGTTGATTTCTACTC
TGGTGTTATTTATAGAGCTATGGGTTTCCCCACTGATATGTTCCCAGTCCTTTTCACTAT
TCCAAGAGTTGCTGGTTGGTTAGCTCATTGGGTTGAATACCTCGATGATAAGGAAAACAA
CATTGTTAGACCCAGACAAAACTATGTTGGCTATGCTAAAAGAGATTATGTTCCTATGGA
ATAAAGACAAGAAGTAATTAACAATTAATTAAATTAAAATTTTTATCATTCATTATAATT
AATAGGCTAAATTTAACTTAGAAAGCTCCAAGAGTTCTACTTCCAAGAGAAGAGAAGCTG
GTACAAGCGTTGTTTTGTGA