Identifiers and Description

Gene Model Identifier

TTHERM_00529790

Standard Name

CIT1 (CITrate synthase 1)

Aliases

PreTt04648 | 67.m00163 | 3684.m00033

Description

Citrate synthase; bifunctional 14-nm filament-forming protein; structural protein involved in oral morphogenesis and pronuclear behavior during conjugation; citrate synthase activity decreased by polymerization and dephosphorylation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00529790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13671.19.997093137033517e-262citrate synthase (463 aa)
SGDYNR001C2.0004037638327014e-151CIT1 Citrate synthase, catalyz
es the condensation of acetyl
coenzyme A and oxaloacetate to
form citrate; the rate-limiti
ng enzyme of the TCA cycle; nu
clear encoded mitochondrial pr
otein
DictyBaseDDB_G02753116.998976675167566e-150DDB_G0275311 on chromosome: 2
position 5329126 to 5331271
WormBaseWBGene000008332.0000633521090825e-149locus:cts-1 Probable citrate
synthase, mitochondrial sta
tus:Confirmed UniProt:P34575
protein_id:CAA83004.1
OxytrichaContig5416.0.g819.003994373438572e-143Citrate synthase
Stentor CoeruleusSteCoe_311341.0648786602415064e-63

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15170257: Mukai A, Endoh H (2004) Presence of a bacterial-like citrate synthase gene in Tetrahymena thermophila: recent lateral gene transfers (LGT) or multiple gene losses subsequent to a single ancient LGT? Journal of molecular evolution 58(5):540-9
  2. Ref:12025402: Kojima H, Numata O (2002) Enzymatic form and cytoskeletal form of bifunctional Tetrahymena 49kDa protein is regulated by phosphorylation. Zoological science 19(1):37-42
  3. Ref:11260259: Takeda T, Yoshihama I, Numata O (2001) Identification of Tetrahymena hsp60 as a 14-nm filament protein/citrate synthase-binding protein and its possible involvement in the oral apparatus formation. Genes to cells : devoted to molecular & cellular mechanisms 6(2):139-49
  4. Ref:9268687: Takeda T, Watanabe Y, Numata O (1997) Direct demonstration of the bifunctional property of Tetrahymena 14-nm filament protein/citrate synthase following expression of the gene in Escherichia coli. Biochemical and biophysical research communications 237(2):205-10
  5. Ref:9443816: Kojima H, Watanabe Y, Numata O (1997) The dual functions of Tetrahymena citrate synthase are due to the polymorphism of its isoforms. Journal of biochemistry 122(5):998-1003
  6. Ref:8575889: Numata O (1996) Multifunctional proteins in Tetrahymena: 14-nm filament protein/citrate synthase and translation elongation factor-1 alpha. International review of cytology 164( ):1-35
  7. Ref:7592552: Takeda T, Kurasawa Y, Watanabe Y, Numata O (1995) Polymerization of highly purified Tetrahymena 14-nm filament protein/citrate synthase into filaments and its possible role in regulation of enzymatic activity. Journal of biochemistry 117(4):869-74
  8. Ref:7737352: Numata O, Yasuda T, Watanabe Y (1995) Tetrahymena intramitochondrial filamentous inclusions contain 14-nm filament protein/citrate synthase. Experimental cell research 218(1):123-31
  9. Ref:8537311: Kojima H, Chiba J, Watanabe Y, Numata O (1995) Citrate synthase purified from Tetrahymena mitochondria is identical with Tetrahymena 14-nm filament protein. Journal of biochemistry 118(1):189-95
  10. Ref:1385189: Kurasawa Y, Numata O, Katoh M, Hirano H, Chiba J, Watanabe Y (1992) Identification of Tetrahymena 14-nm filament-associated protein as elongation factor 1 alpha. Experimental cell research 203(1):251-8
  11. Ref:1993043: Numata O, Takemasa T, Takagi I, Hirono M, Hirano H, Chiba J, Watanabe Y (1991) Tetrahymena 14-nm filament-forming protein has citrate synthase activity. Biochemical and biophysical research communications 174(2):1028-34
  12. Ref:3883198: Numata O, Sugai T, Watanabe Y (1985) Control of germ cell nuclear behaviour at fertilization by Tetrahymena intermediate filament protein. Nature 314(6007):192-4
  13. Ref:6414830: Numata O, Hirono M, Watanabe Y (1983) Involvement of Tetrahymena intermediate filament protein, a 49K protein, in the oral morphogenesis. Experimental cell research 148(1):207-20
  14. Ref:6401983: Fabregat I, Satrústegui J, Machado A (1983) Citrate synthase of Tetrahymena pyriformis: evolutionary and regulatory aspects. Archives of biochemistry and biophysics 220(2):354-60
  15. Ref:6807972: Numata O, Watanabe Y (1982) In vitro assembly and disassembly of 14-nm filament from Tetrahymena pyriformis. The protein component of 14-nm filament is a 49,000-Dalton protein. Journal of biochemistry 91(5):1563-73
  16. Ref:14168: Levy MR, McConkey CL (1977) Enzyme inactivation by a cellular neutral protease: enzyme specificity, effects of ligands on inactivation, and implications for the regulation of enzyme degradation. Journal of cellular physiology 90(2):253-63

Sequences

>TTHERM_00529790(coding)
ATGAGATCTATCAACTAACTTCTTAAGCAAGCTAGCTTATCCCAAAAGAGCCAATACAAC
TTTAGTCAAACCAACTTAAAGAAGGTTATTGCTGAAATTATTCCTCAAAAGCAAGCTGAA
TTAAAGGAAGTCAAGGAAAAGTATGGTGATAAGGTTGTTGGTTAATACACTGTCAAGTAA
GTCATCGGTGGTATGAGAGGTATGAAGGGTCTTATGAGTGATCTCTCTCGTTGCGACCCC
TATCAAGGTATTATTTTCAGAGGCTACACTATTCCTCAACTTAAGGAATTCTTGCCTAAG
GCTGATCCTAAGGCTGCTGACTAAGCCAACTAAGAACCTTTACCTGAAGGTATTTTCTGG
TTATTAATGACCGGTTAATTACCCACCCACGCTTAAGTCGATGCTCTTAAGCACGAATGG
TAAAACAGAGGTACCGTCAACTAAGACTGTGTCAACTTCATTTTGAACTTACCCAAGGAC
CTCCACTCCATGACCATGCTCTCTATGGCCCTCCTTTACCTCCAAAAGGATTCTAAGTTC
GCTAAGCTTTACGACGAAGGTAAGATCTCCAAGAAAGATTACTGGGAGCCCTTCTACGAA
GATTCCATGGACCTTATTGCTAAGATCCCCAGAGTTGCTGCTATTATCTACAGACATAAA
TACAGAGATTCCAAGTTAATTGACTCTGATTCTAAGTTAGATTGGGCTGGTAACTACGCT
CATATGATGGGTTTCGAATAACACGTCGTTAAGGAATGTATTAGAGGTTATTTGAGCATC
CACTGTGATCACGAAGGTGGTAATGTTTCTGCCCATACTACTCACTTGGTCGGTTCTGCT
CTTTCTGATCCTTATCTTTCTTACTCTGCTGGTGTTAACGGTCTTGCCGGTCCCCTCCAC
GGTCTTGCTAACTAAGAAGTCCTTAAGTGGTTACTCTAATTCATTGAAGAAAAGGGTACC
AAGGTTTCTGACAAGGACATTGAAGACTACGTTGATCACGTTATTTCTTCTGGAAGAGTC
GTTCCTGGTTACGGACACGCTGTCTTGAGAGATACCGATCCTAGATTCCACCATTAAGTC
GATTTCTCCAAGTTCCACTTGAAGGATGACTAAATGATCAAATTATTACATTAATGTGCT
GATGTTATCCCCAAGAAATTATTAACTTACAAGAAGATTGCTAATCCTTATCCCAATGTT
GATTGCCACTCTGGTGTTTTATTATACTCTTTGGGCTTAACTGAATATCAATATTACACT
GTTGTCTTCGCCGTTTCTAGAGCTCTTGGTTGTATGGCTAACCTCATCTGGTCTAGAGCT
TTCGGTTTACCCATTGAAAGACCTGGCTCTGCTGATCTTAAGTGGTTCCACGACAAGTAC
AGAGAATGA


>TTHERM_00529790(protein)
MRSINQLLKQASLSQKSQYNFSQTNLKKVIAEIIPQKQAELKEVKEKYGDKVVGQYTVKQ
VIGGMRGMKGLMSDLSRCDPYQGIIFRGYTIPQLKEFLPKADPKAADQANQEPLPEGIFW
LLMTGQLPTHAQVDALKHEWQNRGTVNQDCVNFILNLPKDLHSMTMLSMALLYLQKDSKF
AKLYDEGKISKKDYWEPFYEDSMDLIAKIPRVAAIIYRHKYRDSKLIDSDSKLDWAGNYA
HMMGFEQHVVKECIRGYLSIHCDHEGGNVSAHTTHLVGSALSDPYLSYSAGVNGLAGPLH
GLANQEVLKWLLQFIEEKGTKVSDKDIEDYVDHVISSGRVVPGYGHAVLRDTDPRFHHQV
DFSKFHLKDDQMIKLLHQCADVIPKKLLTYKKIANPYPNVDCHSGVLLYSLGLTEYQYYT
VVFAVSRALGCMANLIWSRAFGLPIERPGSADLKWFHDKYRE


>TTHERM_00529790(gene)
ATGAGATCTATCAACTAACTTCTTAAGCAAGCTAGCTTATCCCAAAAGAGCCAATACAAC
TTTAGTCAAACCAACTTAAAGAAGGTTATTGCTGAAATTATTCCTCAAAAGCAAGCTGAA
TTAAAGGAAGTCAAGGAAAAGTATGGTGATAAGGTTGTTGGTTAATACACTGTCAAGTAA
GTCATCGGTGGTATGAGAGGTATGAAGGGTCTTATGAGTGATCTCTCTCGTTGCGACCCC
TATCAAGGTATTATTTTCAGAGGCTACACTATTCCTCAACTTAAGGAATTCTTGCCTAAG
GCTGATCCTAAGGCTGCTGACTAAGCCAACTAAGAACCTTTACCTGAAGGTATTTTCTGG
TTATTAATGACCGGTTAATTACCCACCCACGCTTAAGTCGATGCTCTTAAGCACGAATGG
TAAAACAGAGGTACCGTCAACTAAGACTGTGTCAACTTCATTTTGAACTTACCCAAGGAC
CTCCACTCCATGACCATGCTCTCTATGGCCCTCCTTTACCTCCAAAAGGATTCTAAGTTC
GCTAAGCTTTACGACGAAGGTAAGATCTCCAAGAAAGATTACTGGGAGCCCTTCTACGAA
GATTCCATGGACCTTATTGCTAAGATCCCCAGAGTTGCTGCTATTATCTACAGACATAAA
TACAGAGTAAAATTAATAGAATTTTTGTTTCTTAGCTTTATATTTAAATCTACTTTTAGA
AATATCTAACAATATGCTTTTTATCTTCTAATGAATTCAATAAAAAACTAATTTTAAGCA
TGTTAGTTTTTGAAATCGTTTTTAAAATACAATAGAATTTTTTTTCTTCTAGTGCTACCC
TACACTGATTTACTGATAGCTATTTATATAAGCATCTTAATTTTAACTGTATTAACAAAA
TTTCATTTATATTATAGGATTCCAAGTTAATTGACTCTGATTCTAAGTTAGATTGGGCTG
GTAACTACGCTCATATGATGGGTTTCGAATAACACGTCGTTAAGGAATGTATTAGAGGTT
ATTTGAGCATCCACTGTGATCACGAAGGTGGTAATGTTTCTGCCCATACTACTCACTTGG
TCGGTTCTGCTCTTTCTGATCCTTATCTTTCTTACTCTGCTGGTGTTAACGGTCTTGCCG
GTCCCCTCCACGGTCTTGCTAACTAAGAAGTCCTTAAGTGGTTACTCTAATTCATTGAAG
AAAAGGGTACCAAGGTTTCTGACAAGGACATTGAAGACTACGTTGATCACGTTATTTCTT
CTGGAAGAGTCGTTCCTGGTAAATTTGAATTTAAATTATATTATTTATAAATAGCAATCA
ATCATCATTGTCATAAAAATCGCAAGTTAAGTTAAAAATATAAGCAAAATTTAATATTTT
TTATAGAAAGAGTTTAGCTATTAAAGAAATAGCAAAGATAAGATTTAGATAAATAAGCAC
TTCAATAGTATTAGCACAAAATAAAACTACTTATTAAGCACAGTTAATCATAAAATTAAA
AATAAAAATTATTTACAACAAATATTTAGTAGACTTACCTCACATATTAAGATAAATAAA
TTATCTCGAAAACATCAAGAATCTTAAATAAAGATTAATAAAAGCAATCAATCACTTGCC
AGAATTTTCTGATCACAATTTATATTAAAATAATAAAGAAATAAATAAATAATGGAAGGA
AATATAATTCATAAATAAATTAAGTATTTATGAAAAAATTAAAAAAAAAAATTATTCTTA
ACATCACATCAATTAAGACTTTCCAGTTTGATAAAAAACATAAACGGCATAATATTATTT
GATGATTGATTATTACGATAATAGCATAAGCTTATAAAATTTCATACTTTTTAAACACTT
TTATAATACAATTCCTAAATTGTTATTACTAAACAATAGGTTACGGACACGCTGTCTTGA
GAGATACCGATCCTAGATTCCACCATTAAGTCGATTTCTCCAAGTTCCACTTGAAGGATG
ACTAAATGATCAAATTATTACATTAATGTGCTGATGTTATCCCCAAGAAATTATTAACTT
ACAAGAAGATTGCTAATCCTTATCCCAATGTTGATTGCCACTCTGGTGTTTTATTATACT
CTTTGGGCTTAACTGAATATCAATATTACACTGTTGTCTTCGCCGTTTCTAGAGCTCTTG
GTTGTATGGCTAACCTCATCTGGTCTAGAGCTTTCGGTTTACCCATTGAAAGACCTGGCT
CTGCTGATCTTAAGTGGTTCCACGACAAGTACAGAGAATGA