Identifiers and Description

Gene Model Identifier

TTHERM_00113090

Standard Name

CHS4 (CHitin Synthase)

Aliases

PreTt27123 | 8.m00383 | 3812.m02420

Description

Chitin synthase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00113090

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03917.19.997093137033517e-262chitin synthase (1249 aa)
OxytrichaContig20733.0.g188.00284826019147e-27Chitin synthase
SGDYBR038W3.999672240330216e-26CHS2 Chitin synthase II; catal
yzes transfer of N-acetylgluco
samine (GlcNAc) to chitin upon
activation of zymogenic form;
required for chitin synthesis
in the primary septum during
cytokinesis; localization regu
lated by Cdk1p during mitosis
Stentor CoeruleusSteCoe_159990.0000000000002543665647376923
WormBaseWBGene000004970.00000019998969434520019locus:chs-2 status:Confirmed
UniProt:G5EBQ8 protein_id
:CCD71483.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00113090(coding)
ATGAATAAAAAGGTTGATAATTCTTTAAACACTCCTTTTATTGTTGATGAAGGAGAAGAC
GATGATGGTGAATCTTCAAATGTTCCATTCAATCTTAGTGATGTTTTACAAGATTCTTCA
AAAGCTTAAAACGGAAATGGAGATTATTAAATTAAACAACTTCCTTTTAATTATGATTAA
TATTCTTAGTAGCCTGTCTCAAATTAGTAACCCTCTACATAGCCCAGTCTCTCCATTAAA
AAAGAAAAGAGTACTAATCGCAAGCCAGGAACAGTCCACTTTTAAGACAAAAGTCAGGTT
ATTATTGAAGACAACAATGAAAACCACGAAAGCCCAAGAAATTCAAAATAATAATTAGAC
TTAAATTCAAATATTAGTAAAAAGTCTTATAATGAAGAAGTAAGCACAGAAAAAAACAAT
GTTCTGAATTTGAATGATGATGATATTGAAGTTAACTACGGTAAAGGTGAAACTCCTCTC
GATTTGTTCTTAGAAGGTACTTACGAAGATGGTAAGAAAACTACTCTTGACCCTCTTACT
GTTTTCAGACCTAAAGTTAAACCTAAAATATAAGATTTGAAGAATGGATAGTAGACTTAT
GTACACTTCGACGAAAAATCATACTACAACCCAGGTGTCTTAAGATCAATTGATTAGAAT
GATGGGTTCTTGGGTTATTATTCAATGCCATGGACTAAGAAGAACTAAACTTTGAAGATG
TTAGTTTGTGTTACTATGTATTCTGAAGAAAGAGTTTTCTTAGAGCAAACTTTGTACCAC
ATCTTTAAGAATATGAGAGGATTTGAAGAAATTGGTTTAAAAGACTTCTAGATTGTTGTC
GTTGTCATTCAAGATGGTATTACAAAGATGAAAGAAGAAGTTGTTGATTTCTATTGTGAT
TTGGAAGGTTAAAACAGAAACGTAGATAGAAATTTAAAGCTTAGACGTTATGAAATTTCT
AAGCAAGAACAATTTTTATAATACAAAGGTTAATAAAAGGTTTTAGATTCAAATGAAGGT
TTACCTTTAACTATTCCAAAGCGTACAGCACTAGTCTATCAAAATAGACTTTAATTCGTA
AAGGAAAATTAAAATAAAAAGGAAGAAAGACCTAAGGTTTATAGTTCAAATCACTATCAA
TATGACACTTCAAAACCAGGTTTAACCGTTTTCAGTGTCTTTAAGCATAAAAATGCTAAA
AAATTATCTTCCCATATGTGGTTTTTCGAAGGTTTCTGTCGTTAATTCAGACCTAAATAT
TGTGCTCTAGTCGATGTCGGAACTTTGCCTGCTTCAGATGGTTTGCTAAAGTTTTACATA
GCTATGGAAGGAAATTCAAAAGTAGGTGGTGTTTGTGGTTTCTTGGGTTTGGAAGATCCA
CCTGAGTATGACGAATTGCTTGATGAAGCAGAAACACCTCACATGATGGAATTAAATCAA
ATTCTTGATGAAAAAAAGAAGACTTTAGATAATTGGTAGAAGGACTTTGAAGAAAGAAAA
CGCATAGATAAACAAAAGCAAGAACAAAAAAATAGAGAAGAAAACTAGGTTTTTATAAAT
GAAGAATTAGAAGAAAGAAAGAAAAAACATTTTGATAGCAAACACAGAACTCATAAAATA
TTCTAATATACAATTTTCTTACCAGTAATGCTCCTTCAGATTGGAATTGGTCTTGTTTAT
TGGATTATAAGAAAAGCCATCTTTAAAGCTATTTTTAGATTTTTCAGATGGTTTGCAGTC
AATTATTTAGATATATTCGCTAGTTTGAAAAAAGCTTAGCTCTATGAATACACAATGGCG
CATATGGTAGATAAAAATTTCGAATCTTTACTAGGTTTTCTTCACGTGCTTCCCGGTGCT
TGGTCTGCCTATAGATACGAAGCTTTAGAAGTTAAGTTTTCAAATAGATAAAATTTATTG
CAAAGAAAGTATTTTAAGTAATTAGTTAATCCTGATAAATTAGAAGGTAACATCAAAGAA
GCTAATATGTTCTTGGCTGAAGATAGAATTTTATGTTTAGGTATTTACTGCTAACCTGAT
TCAAACTTTACACTTAAATTTATCCCTGATGCTAAGGCTTTCACAGATCCTGTTGGTACT
TTAGAAGAATTCATGAACTAAAGAAGAAGATGGATTAATAGTACTATGTTTGCCTTGGAT
TATGTGCTCAAACATTATTCATTCCACGTTGAAGAAAGTAGCCACTCCAGCACTGAAAAG
GGTTTCTTACTGCCATTTAATATGTTATTCGCTAAAATAGGTGATATTAACTCTTACTTT
ATTCCTGCCTTTTACTTCTTTGTTGCTTTGATGAGTAGTTTCTAGCTTTTGTCACCTGAA
ATATAGAAAGGTTATTCTTATGTTCCTTTTGATGGCGAAACTGTCAAATTTAAGTGCATA
GTTGGTAAAAAAATTGCGGATTACGAAAATGAATGTGATTATGATACTGGTATTTCAGAA
GGCTGTTACCAATAATGTGAATCTACTGCCTATCCAAAAGCTTTCTATGTTACTCTTAAC
TTAATTCCTTTCATTTATATTGTTTGCTTCTTGCTTATTGTTTTTGCAAGTCTTACTTTC
AAAGTTAGAAGATTAGCATAAAATGCTTATGAAAACCTCAGAAGAATGATATTGACTGAT
GAATAAAGAGGTGATATCAAAGCCATGGAAGACAACATTAAAGATTTGGAAGTTTCTATG
TCAAGATTATAGGAAAAGAAAGATATTTAAAAGTAGAAGAAGGAAATCGAAAAGGAAAAA
AGACGTGTCAGAGTTGAAATTTTTAAAGTGACCCAAACCACTTTTGAGATGCTTGTTGCT
AAGATCAGTGAACATCACATTAAGCTATCTCCTTCTGAGAAAAAATTCAAAATTGAATAT
GATAAGATTACTTCTCAGGAATATGCAAATGATATCTTCAAAATTCTTGCTACTGTTATG
TCTTTGATGAGTATTGTAATTATGCTTGTTGTTGGTTTGGCTATTGCTATGAATATATTC
AATAGCGGTTTTGGTATCATTAATGGTTTCGTTAAGTTAGATGGCTGGTTAAGACTTTAT
ATCATTATCATGGTTATCATAAACATGGGATCATTCTTTGGTATTCTATTGGTCCATCTT
TTTATTTAACCCAAATTAGTGTGGTACATCTTTATTTCTTATTGGAGTTACATTGTCTAT
TAGCCTATTTATAACTTTATTTTGATCATCTTCTCTTTCTGTAACATTGACGATGTCACT
TGGGGAACAAAGGGTCTCTCAGATTCTAAAGAAGCTAATAGCTACTATTAAGAAAAAGTT
AAATTTTTGATCAGATGGTTTGCCTCTAACATTGTCCTCCTCTTAGCCTTAATTGGTGGT
AATGTCTTTACTGGAAAGACACCATATATCATTCTCTTTATCGGTCTATATGGTACTGCA
TATCTAGCCATAAAAACAATATTGGCTATAATTAATTATATTAAGTATTTCATCTTCAAT
AAAATCTACTACAAATACCAAATTCACAAAACAAAGAAGAAAAACGAAGAATCTCAAGAA
CTTTTGAAATAAGAATATAACAGATTTATCTCTACTATGGAAAACAACAGATTAAGAAGT
GTTTCTAGATACGACTATCCAATTTATAAATAAAACCCCTCTATTTCTGGATCAATGTAC
TAAGAAAACTTGATCTTCCACTCTAAATTCAATCAGAGAGTTTCTAACTTTTAAGGTATT
GGATCTTCAAGTAATGTAACTGTAAATGTTAATTAACCTAATAACTAGTAACCTTAACAT
CCAACCCTTAACTAAAACTAAACCCCAATTTCTCCTTAACATTCTCAAAAATGA


>TTHERM_00113090(protein)
MNKKVDNSLNTPFIVDEGEDDDGESSNVPFNLSDVLQDSSKAQNGNGDYQIKQLPFNYDQ
YSQQPVSNQQPSTQPSLSIKKEKSTNRKPGTVHFQDKSQVIIEDNNENHESPRNSKQQLD
LNSNISKKSYNEEVSTEKNNVLNLNDDDIEVNYGKGETPLDLFLEGTYEDGKKTTLDPLT
VFRPKVKPKIQDLKNGQQTYVHFDEKSYYNPGVLRSIDQNDGFLGYYSMPWTKKNQTLKM
LVCVTMYSEERVFLEQTLYHIFKNMRGFEEIGLKDFQIVVVVIQDGITKMKEEVVDFYCD
LEGQNRNVDRNLKLRRYEISKQEQFLQYKGQQKVLDSNEGLPLTIPKRTALVYQNRLQFV
KENQNKKEERPKVYSSNHYQYDTSKPGLTVFSVFKHKNAKKLSSHMWFFEGFCRQFRPKY
CALVDVGTLPASDGLLKFYIAMEGNSKVGGVCGFLGLEDPPEYDELLDEAETPHMMELNQ
ILDEKKKTLDNWQKDFEERKRIDKQKQEQKNREENQVFINEELEERKKKHFDSKHRTHKI
FQYTIFLPVMLLQIGIGLVYWIIRKAIFKAIFRFFRWFAVNYLDIFASLKKAQLYEYTMA
HMVDKNFESLLGFLHVLPGAWSAYRYEALEVKFSNRQNLLQRKYFKQLVNPDKLEGNIKE
ANMFLAEDRILCLGIYCQPDSNFTLKFIPDAKAFTDPVGTLEEFMNQRRRWINSTMFALD
YVLKHYSFHVEESSHSSTEKGFLLPFNMLFAKIGDINSYFIPAFYFFVALMSSFQLLSPE
IQKGYSYVPFDGETVKFKCIVGKKIADYENECDYDTGISEGCYQQCESTAYPKAFYVTLN
LIPFIYIVCFLLIVFASLTFKVRRLAQNAYENLRRMILTDEQRGDIKAMEDNIKDLEVSM
SRLQEKKDIQKQKKEIEKEKRRVRVEIFKVTQTTFEMLVAKISEHHIKLSPSEKKFKIEY
DKITSQEYANDIFKILATVMSLMSIVIMLVVGLAIAMNIFNSGFGIINGFVKLDGWLRLY
IIIMVIINMGSFFGILLVHLFIQPKLVWYIFISYWSYIVYQPIYNFILIIFSFCNIDDVT
WGTKGLSDSKEANSYYQEKVKFLIRWFASNIVLLLALIGGNVFTGKTPYIILFIGLYGTA
YLAIKTILAIINYIKYFIFNKIYYKYQIHKTKKKNEESQELLKQEYNRFISTMENNRLRS
VSRYDYPIYKQNPSISGSMYQENLIFHSKFNQRVSNFQGIGSSSNVTVNVNQPNNQQPQH
PTLNQNQTPISPQHSQK


>TTHERM_00113090(gene)
ATGAATAAAAAGGTTGATAATTCTTTAAACACTCCTTTTATTGTTGATGAAGGAGAAGAC
GATGATGGTGAATCTTCAAATGTTCCATTCAATCTTAGTGATGTTTTACAAGATTCTTCA
AAAGCTTAAAACGGAAATGGAGATTATTAAATTAAACAACTTCCTTTTAATTATGATTAA
TATTCTTAGTAGCCTGTCTCAAATTAGTAACCCTCTACATAGCCCAGTCTCTCCATTAAA
AAAGAAAAGAGTACTAATCGCAAGCCAGGAACAGTCCACTTTTAAGACAAAAGTCAGGTT
ATTATTGAAGACAACAATGAAAACCACGAAAGCCCAAGAAATTCAAAATAATAATTAGAC
TTAAATTCAAATATTAGTAAAAAGTCTTATAATGAAGAAGTAAGCACAGAAAAAAACAAT
GTTCTGAATTTGAATGATGATGATATTGAAGTTAACTACGGTAAAGGTGAAACTCCTCTC
GATTTGTTCTTAGAAGGTACTTACGAAGATGGTAAGAAAACTACTCTTGACCCTCTTACT
GTTTTCAGACCTAAAGTTAAACCTAAAATATAAGATTTGAAGAATGGATAGTAGACTTAT
GTACACTTCGACGAAAAATCATACTACAACCCAGGGTAATATAATAAATACATTTTATTA
ATTTTCCTTGAATGTGCTTTGATAATAGTGGATATATTTATGAATTAAAAATACAGATTA
AGATAAAACCTTTAATTAAACAAATCTCAAAAAAAAAAAAAAAAAAATTAAAATTGATGT
TTGATTAGGATAATTAATTTATTTAGAGCCATTCAGAATTTAACATTAATTATTTTTATT
ATTAATTGTAATTAATTCGAGTGAAGATATTTTTTTTTTTTTTTTTCTTTTTGGAGAAAA
GTAAAATAAATTATGATTGAATTGATTGAGCTTTTCATATTTTGTTTTATTAAAAATATT
TTTAAAATTATTTAAATAGTGTCTTAAGATCAATTGATTAGAATGATGGGTTCTTGGGTT
ATTATTCAATGCCATGGACTAAGAAGAACTAAACTTTGAAGATGTTAGTTTGTGTTACTA
TGTATTCTGAAGAAAGAGTTTTCTTAGAGCAAACTTTGTACCACATCTTTAAGAATATGA
GAGGATTTGAAGAAATTGGTTTAAAAGACTTCTAGATTGTTGTCGTTGTCATTCAAGATG
GTATTACAAAGATGAAAGAAGAAGTTGTTGATTTCTATTGTGATTTGGAAGGTTAAAACA
GAAACGTAGATAGAAATTTAAAGCTTAGACGTTATGAAATTTCTAAGCAAGAACAATTTT
TATAATACAAAGGTTAATAAAAGGTTTTAGATTCAAATGAAGGTTTACCTTTAACTATTC
CAAAGCGTACAGCACTAGTCTATCAAAATAGACTTTAATTCGTAAAGGAAAATTAAAATA
AAAAGGAAGAAAGACCTAAGGTTTATAGTTCAAATCACTATCAATATGACACTTCAAAAC
CAGGTTTAACCGTTTTCAGTGTCTTTAAGCATAAAAATGCTAAAAAATTATCTTCCCATA
TGTGGTTTTTCGAAGGTTTCTGTCGTTAATTCAGACCTAAATATTGTGCTCTAGTCGATG
TCGGAACTTTGGTAAAAAACAAACATCATCTTATTTTTTATTTTATTCATCAACAAAAAA
AACTAAAAATTTATTTTATTTTTTAATAAGCCTGCTTCAGATGGTTTGCTAAAGTTTTAC
ATAGCTATGGAAGGAAATTCAAAAGTAGGTGGTGTTTGTGGTTTCTTGGGTTTGGAAGAT
CCACCTGAGTATGACGAATTGCTTGATGAAGCAGAAACACCTCACATGATGGAATTAAAT
CAAATTCTTGATGAAAAAAAGAAGACTTTAGATAATTGGTAGAAGGACTTTGAAGAAAGA
AAACGCATAGATAAACAAAAGCAAGAACAAAAAAATAGAGAAGAAAACTAGGTTTTTATA
AATGAAGAATTAGAAGAAAGAAAGAAAAAACATTTTGATAGCAAACACAGAACTCATAAA
ATATTCTAATATACAATTTTCTTACCAGTAATGCTCCTTCAGATTGGAATTGGTCTTGTT
TATTGGATTATAAGAAAAGCCATCTTTAAAGCTATTTTTAGATTTTTCAGATGGTTTGCA
GTCAATTATTTAGATATATTCGCTAGTTTGAAAAAAGCTTAGCTCTATGAATACACAATG
GCGCATATGGTAGATAAAAATTTCGAATCTTTACTAGGTTTTCTTCACGTGCTTCCCGGT
GCTTGGTCTGCCTATAGGTAACAAACAAATAAACAAATTGCTTTACAACATTTTATAGAA
ATACAATCCTAGAATTTAATTCTTTAACAACTTAATAAAAATGACTCAAATAAATTAATT
TATTTATCTAAATTTATTTTAATTAATTAATAGATACGAAGCTTTAGAAGTTAAGTTTTC
AAATAGATAAAATTTATTGCAAAGAAAGTATTTTAAGTAATTAGTTAATCCTGATAAATT
AGAAGGTAACATCAAAGAAGCTAATATGTTCTTGGCTGAAGATAGAATTTTATGTTTAGG
TATTTACTGCTAACCTGATTCAAACTTTACGTAATTAATTTATTGATAAAAAACTTCTTT
CATTTCAGAAATATATCAACTAAAAGAAAGAAATATATATATAGATAAATAGATAGATAG
ATAAATTTTATAAATAGCAATTAAATATAGACTTATAAATAATATTTATGACTTATATTT
TTTTCAAATTATAGACTTAAATTTATCCCTGATGCTAAGGCTTTCACAGATCCTGTTGGT
ACTTTAGAAGAATTCATGAACTAAAGAAGAAGATGGATTAATAGTACTATGTTTGCCTTG
GATTATGTGCTCAAACATTATTCATTCCACGTTGAAGAAAGTAGCCACTCCAGCACTGAA
AAGGGTTTCTTACTGCCATTTAATATGTTATTCGCTAAAATAGGTGATATTAACTCTTAC
TTTATTCCTGCCTTTTACTTCTTTGTTGCTTTGATGAGTAGTTTCTAGCTTTTGTCACCT
GAAATATAGAAAGGTTATTCTTATGTTCCTTTTGATGGCGAAACTGTCAAATTTAAGTGC
ATAGTTGGTAAAAAAATTGCGGATTACGAAAATGAATGTGATTATGATACTGGTATTTCA
GAAGGCTGTTACCAATAATGTGAATCTACTGCCTATCCAAAGTAAACATAATTTTAAAAT
ATTACCAACTAATTAATATTTATTTAATTATTATAAAAATAATAGAGCTTTCTATGTTAC
TCTTAACTTAATTCCTTTCATTTATATTGTTTGCTTCTTGCTTATTGTTTTTGCAAGTCT
TACTTTCAAAGTTAGAAGATTAGCATAAAATGCTTATGAAAACCTCAGAAGAATGATATT
GACTGATGAATAAAGAGGTGATATCAAAGCCATGGAAGACAACATTAAAGATTTGGAAGT
TTCTATGTCAAGATTATAGGAAAAGAAAGATATTTAAAAGTAGAAGAAGGAAATCGAAAA
GGAAAAAAGACGTGTCAGAGTTGAAATTTTTAAAGTGACCCAAACCACTTTTGAGATGCT
TGTTGCTAAGATCAGTGAACATCACATTAAGCTATCTCCTTCTGAGAAAAAATTCAAAAT
TGAATATGATAAGATTGTAAATAAATAAATAAAAATTCAATTTAAAAAATAATATTTTCA
TAAATTTATTCAAAAAGACTTCTCAGGAATATGCAAATGATATCTTCAAAATTCTTGCTA
CTGTTATGTCTTTGATGGTAACTAATTAATTAATTAAACTTTCTTTTGAATAGTAAAAAA
TTTTAATTAATTTATTTATATAAATAAATAGAGTATTGTAATTATGCTTGTTGTTGGTTT
GGCTATTGCTATGAATATATTCAATAGCGGTTTTGGTATCATTAATGGTTTCGTTAAGTT
AGATGGCTGGTTAAGACTTTATATCATTATCATGGTTATCATAAACATGGGATCATTCTT
TGGTATTCTATTGGTCCATCTTTTTATTTAACCCAAATTAGTGTGGTACATCTTTATTTC
TTATTGGAGTTACATTGTCTATTAGCCTATTTATAACTTTATTTTGATCATCTTCTCTTT
CTGTAACATTGACGATGTCACTTGGGGAACAAAGGGTCTCTCAGATTCTAAAGAAGCTAA
TAGCTACTATTAAGAAAAAGTTAAATTTTTGATCAGATGGTTTGCCTCTAACATTGTCCT
CCTCTTAGCCTTAATTGGTGGTAATGTCTTTACTGGAAAGACACCATATATCATTCTCTT
TATCGGTCTATATGGTACTGCATATCTAGCCATAAAAACAATATGTAAATTACACATTAA
AAGCAAAAAAATAAATAAATATATTAATTAATTTTTTCTATAAAAAAGTGGCTATAATTA
ATTATATTAAGTATTTCATCTTCAATAAAATCTACTACAAATACCAAATTCACAAAACAA
AGAAGAAAAACGAAGAATCTCAAGAACTTTTGAAATAAGAATATAACAGATTTATCTCTA
CTATGGAAAACAACAGATTAAGAAGTGTTTCTAGATACGACTATCCAATTTATAAATAAA
ACCCCTCTATTTCTGGATCAATGTACTAAGAAAACTTGATCTTCCACTCTAAATTCAATC
AGAGAGTTTCTAACTTTTAAGGTATTGGATCTTCAAGTAATGTAACTGTAAATGTTAATT
AACCTAATAACTAGTAACCTTAACATCCAACCCTTAACTAAAACTAAACCCCAATTTCTC
CTTAACATTCTCAAAAATGA