Identifiers and Description

Gene Model Identifier

TTHERM_00134900

Standard Name

CHS2 (CHitin Synthase)

Aliases

PreTt24314 | 10.m00363 | 3698.m00084

Description

Chitin synthase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.2%

TetraMine Data

TTHERM_00134900

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14868.19.997093137033517e-262chitin synthase (884 aa)
SGDYNL192W9.998397555368434e-52CHS1 Chitin synthase I, requir
es activation from zymogenic f
orm in order to catalyze the t
ransfer of N-acetylglucosamine
(GlcNAc) to chitin; required
for repairing the chitin septu
m during cytokinesis; transcri
ption activated by mating fact
or
OxytrichaContig19394.0.g629.999888128184441e-42Chitin synthase
Stentor CoeruleusSteCoe_159992.9374821117108028e-30
WormBaseWBGene000004970.000000000007996637300921877locus:chs-2 status:Confirmed
UniProt:G5EBQ8 protein_id
:CCD71483.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00134900(coding)
ATGCATAATAATAACTCCTTTATCAAGGATTTAAAGTTCTTACAGCCCCTTGAAGTTTAG
CTTCAGAGAGATGAGTACACAAGCAAATTCAATTTAGAAGCAAGGATAAATGATATTAAT
GAGTTCAGAGAAATTGATATTTTGGATAGAGATATCCATAAAAATCAGCATGGACTTATT
TCGCTCTATAATCATAATTCCAAGATAAAAATTGAACCTAAATTAATGATTTGCATAACT
ATGTACAATGAATCAAGAAAAGAATTGGAATCAACATTAAATGGTATATTCAAGAATGTA
AAGACTTTTAAAGAGGAATGTCTTGTAGATAACTTAGAAATTGTAGTCGTTATTATATAT
GATGGTATGAATAAGCTTTGTACTACTACTTAAGAAGAACTTGTAGATATAGATGAGGAT
ATGCTGGAATACTTCATAGCTTAAGACAAGAAGATATAGAATGATGATAAAGAATTCAAC
ATGAAATATCAGCATGAAACTTACTGCTATAATCTCAAATTGTCTTAAATCAAAATAGAT
GAAGAAGAACACAAAAATAAATTTGAAATATTTGACTAAGATAAGAAGATTAAGCATAAT
TACGAACAATGGAAAATCTCCAATCAACACTATAATGAGAAAGAAGGAAAAAGAAAATTT
TTGCAAGATGAAAAAGACGAAGCCTTAAAATACATCTAAAGCAAGAAGAATAATGGATTT
CTCTATTAGATATAATCATCACTTGAGTAAATCGATGACACTATTAATGATTTTCCCGAT
AAAAATAAGAAAAAATCTAAAAACCTAAATACTAGTAAAAAAGATAAAAACCCAGATGAT
ATTGATGATGAATCTATCAGCATTTTCCACTGTGTTAAATATTAAAACGGAGGTAAACTA
TCCAGTCATTTGTGGTTCTTTAGTGGTTTTTGCGAATTATTCTAGCCTTCATACACAATT
TTACTTGATTGTGGTTTAGTTCCTGATGAAAAAGCTCTTTTCAACATGTTTTTGGCATTC
GAAACAGATAAAAACATAGGTGGAGTCTGTGGTTTTATGGGTATTAAATTCTAAGATGTA
TACACTGACGCTGGTCAAAGAAAGGATGAATATAAAAGAGCTCAACCATAAATTGATTTT
CTATCTGACCTATTTTAAAAAATTTTCGATGTATAAAAGGCCTAAATGTACGAATATAAT
ATGGGTCATTTTATTGATAAACCTTTTGAGTCACTTTTTGGTTATATTTAAGTACTTCCT
GGTGCATTCAGTGGTTACAGGTGGGATGCTCTTAAACGTGATGAAGAAACAAAGGATTGC
ATTTTAGATGATTACTTATCCAGTGTATTGGATTAATCAAGAGAACTGACATTAGAACAA
TAAAATATGAATCTCGCAGAAGATAGAATTCTCTGTTTAAAAATTTACTCAAAGCATGGA
AAAAAATATACCTTGAAATATTTGCCTAATTGTCGTGCAAAAGTCGATCCTGTTACAGAT
TTGATGACATTGATCAGCTAAAGAAGGAGATGGATTAATGGTTCTACTTTCGCTTTAAAA
CTTTGCTTAAGAGACAGTAACCTAGTTTATGATTCAGATCACGGTATGTATGATATTATT
AAATTTAAATTGTGCATGGCTTTTGCTTGGTTAAATAACTTCTTGAGTTATATTTCGTTG
TCTGTATTTTTCATTATTGTCTTCATTATGATAGAAACAAATGTTAGCTAAGTTACTTTA
GAAGGCTCAATCCTTAATGGTTCAGCTCTATAATTACTTATTACAACATTATTCTTTGCT
GTTTATTTTATCTCTGTCCTAGTCATTATATACATTTCTCTAATGCTTGATACAAGAAAA
CCTGAGGTTATAAGATCATTCTACCCTATTTCTACATTCTTAGGCTTAGTCATGCTTGTC
GCGTATGTGTTTATGATTATCTACGTTATTTTGACAACTCTCTTTACATGGGATTATTAC
ATTCTTGGAAATAAATTTTCTTAGTATGCTTAGTCTGGTATTTTGTAATCATGGAATGAA
AATTTCCTTAAGGAGTTTTTCTGCTACTTGATTGTTGTTGGATTCTTTATAACTTTTATT
CCTTATATTTTTAATCCTCGCAAAATATTGGAAATGATTATTTCGTTCATTCATTTCATA
GCTTACCAGGCATAGTACATACATCTTTTCACAATTTATGCATACTGTAGAATCGATGAC
TTTTCATGGGGTACCAAGGGTCAAAACACGGCCTCATAATAGTAAGATGTAAGCAAAAGT
ATTAAATTTAAGTTTGTATTATAGTGGTTTTTGACAAACTTCTTTATTGCATTTTTGTTT
TCTTCATTTTTAACCTCAACAATCATGCCTGATGAAATGCAGGAATATGTAAAGCCAGCT
ATTTTGACAAGTATTTCTGTTGTTTTTGTTGGTTAGCTTGTTTTGAGAGTAATTGGAGCT
TTGTTTTATGAACTTTACTTCATTTACTTCAGAAGAAAAATGGCAAGTAAATAAGATGCC
ATCCACCACTTAAGAGAATAAGGAAGTGAAAAAGAATTACTTAAAAAAATCAATGAAATT
AAGCAAACAATTTAGAGATCTTAAGCTCAAGTTGTTGAAGACAGTATATTATAACCTATT
GATAATTAATAAATGACTTAGTATGATAACTAACAATCACATTTAGTTTAACAATTCACT
TAGTTTGGCTAATAAAATACTCAAAATGGCTAATAAAACACTATATATGCTTAATGA


>TTHERM_00134900(protein)
MHNNNSFIKDLKFLQPLEVQLQRDEYTSKFNLEARINDINEFREIDILDRDIHKNQHGLI
SLYNHNSKIKIEPKLMICITMYNESRKELESTLNGIFKNVKTFKEECLVDNLEIVVVIIY
DGMNKLCTTTQEELVDIDEDMLEYFIAQDKKIQNDDKEFNMKYQHETYCYNLKLSQIKID
EEEHKNKFEIFDQDKKIKHNYEQWKISNQHYNEKEGKRKFLQDEKDEALKYIQSKKNNGF
LYQIQSSLEQIDDTINDFPDKNKKKSKNLNTSKKDKNPDDIDDESISIFHCVKYQNGGKL
SSHLWFFSGFCELFQPSYTILLDCGLVPDEKALFNMFLAFETDKNIGGVCGFMGIKFQDV
YTDAGQRKDEYKRAQPQIDFLSDLFQKIFDVQKAQMYEYNMGHFIDKPFESLFGYIQVLP
GAFSGYRWDALKRDEETKDCILDDYLSSVLDQSRELTLEQQNMNLAEDRILCLKIYSKHG
KKYTLKYLPNCRAKVDPVTDLMTLISQRRRWINGSTFALKLCLRDSNLVYDSDHGMYDII
KFKLCMAFAWLNNFLSYISLSVFFIIVFIMIETNVSQVTLEGSILNGSALQLLITTLFFA
VYFISVLVIIYISLMLDTRKPEVIRSFYPISTFLGLVMLVAYVFMIIYVILTTLFTWDYY
ILGNKFSQYAQSGILQSWNENFLKEFFCYLIVVGFFITFIPYIFNPRKILEMIISFIHFI
AYQAQYIHLFTIYAYCRIDDFSWGTKGQNTASQQQDVSKSIKFKFVLQWFLTNFFIAFLF
SSFLTSTIMPDEMQEYVKPAILTSISVVFVGQLVLRVIGALFYELYFIYFRRKMASKQDA
IHHLREQGSEKELLKKINEIKQTIQRSQAQVVEDSILQPIDNQQMTQYDNQQSHLVQQFT
QFGQQNTQNGQQNTIYAQ


>TTHERM_00134900(gene)
ATGCATAATAATAACTCCTTTATCAAGGATTTAAAGTTCTTACAGCCCCTTGAAGTTTAG
CTTCAGAGTAATAATTTGTTTCAACTTTTTTTTTATTTAATATTTATTCAATTCCATATT
CAATCTTTTAATAATAAATTATACATAAAGGAGATGAGTACACAAGCAAATTCAATTTAG
AAGCAAGGATAAATGATATTAATGAGTTCAGAGAAATTGATATTTTGGATAGAGATATCC
ATAAAAATCAGCATGGACTTATTTCGCTCTATAATCATAATTCCAAGATAAAAATTGAAC
CTAAATTAATGATTTGCATAACTATGTACAATGAATCAAGAAAAGAATTGGGTAAATTAA
TAAATTTCATGATAGTTTTTCAAGTAGAAGGAGATAAAAGATCTCAATATGAAAATTTAT
AAATTTATCTTGCTTTTTTGATGTTTATATTTATTTTGTAAATTTATTAGAATCAACATT
AAATGGTATATTCAAGAATGTAAAGACTTTTAAAGAGGAATGTCTTGTAGATAACTTAGA
AATTGTAGTCGTTATTATATATGATGGTATGAATAAGCTTTGTACTACTACTTAAGAAGA
ACTTGTAGATATAGATGAGGATATGCTGGAATACTTCATGTAAATTACACTATAAACCAA
ATTATTAATTTAAAAAGTAAAATTGTAGAGCTTAAGACAAGAAGATATAGAATGATGATA
AAGAATTCAACATGAAATATCAGCATGAAACTTACTGCTATAATCTCAAATTGTCTTAAA
TCAAAATAGATGAAGAAGAACACAAAAATAAATTTGAAATATTTGACTAAGATAAGAAGA
TTAAGCATAATTACGAACAATGGAAAATCTCCAATCAACACTATAATGAGAAAGAAGGAA
AAAGAAAATTTTTGCAAGATGAAAAAGACGAAGCCTTAAAATACATCTAAAGCAAGAAGA
ATAATGGATTGTATCTCTTTTCATTAGAAAATATTCACTTAATAAATTATAATTCATTAT
AAAAAGTCTCTATTAGATATAATCATCACTTGAGTAAATCGATGACACTATTAATGATTT
TCCCGATAAAAATAAGAAAAAATCTAAAAACCTAAATACTAGTAAAAAAGATAAAAACCC
AGATGATATTGATGATGAATCTATCAGCATTTTCCACTGTGTTAAATATTAAAACGGAGG
TAAACTATCCAGTCATTTGTGGTTCTTTAGTGGTTTTTGCGAATTATTCTAGCCTTCATA
CACAATTTTACTTGATTGTGGTTTAGTTCCTGATGAAAAAGCTCTTTTCAACATGTTTTT
GGCATTCGAAACAGATAAAAACATAGGTGGAGTCTGTGGTTTTATGGGTATTAAATTCTA
AGATGTATACACTGACGCTGGTCAAAGAAGTAATTATTTCTTAAATAATTTATTCATTTA
TTTCATTTTTTTCAATAATAAAAGAGGATGAATATAAAAGAGCTCAACCATAAATTGATT
TTCTATCTGACCTATTTTAAAAAATTTTCGATGTATAAAAGGCCTAAATGTACGAATATA
ATATGGGTAATTTTAATTTCAAGTCTATTTTAACCATTATTTCCTAATCAAAATAATAAA
TAAAATAGGTCATTTTATTGATAAACCTTTTGAGTCACTTTTTGGTTATATTTAAGTACT
TCCTGGTGCATTCAGTGGTTACAGGTGGGATGCTCTTAAACGTGATGAAGAAACAAAGGA
TTGCATTTTAGATGATTACTTATCCAGTGTATTGGATTAATCAAGAGAACTGACATTAGA
ACAATAAAATATGAATCTCGCAGAAGATAGAATTCTCTGTTTAAAAATTTACTCAAAGCA
TGGAAAAAAATATACCTTGAAATATTTGCCTAATTGTCGTGCAAAAGTCGATCCTGTTAC
AGATTTGATGACATTGATCAGCTAAAGAAGTAAATTTTATTAAATTAGATATACAAATTT
ATGAATTTAAATTAAACAATAGGGAGATGGATTAATGGTTCTACTTTCGCTTTAAAACTT
GTAATTAATTAATTAATCATTTTATTTCTTTTTTTACAAAAATAAATTTAAAAAAAGTGC
TTAAGAGACAGTAACCTAGTTTATGATTCAGATCACGGTATGTATGATATTATTAAATTT
AAATTGTGCATGGCTTTTGCTTGGTTAAATAACGTATTCTACCTTTTTACTTAATTAATT
TATTTTTTACTAATATTCTATAAAATAAATAATTAAAGTTCTTGAGTTATATTTCGTTGT
CTGTATTTTTCATTATTGTCTTCATTATGATAGAAACAAATGTTAGCTAAGTTACTTTAG
AAGGCTCAATCCTTAATGGTTCAGCTCTATAATTACTTATTACAACATTATTCTTTGCTG
TTTATTTTATCTCTGTCCTAGTCATTATATACATTTCTCTAATGCTTGATACAAGAAAAC
CTGAGGTTATAAGATCATTCTACCCTATTTCTACATTCTTAGGTAAATTTAAAAATAAAT
TTGTTTTATTTAATTTATTTTGTAAATTATTTTAAATAGGCTTAGTCATGCTTGTCGCGT
ATGTGTTTATGATTATCTACGTTATTTTGACAACTCTCTTTACATGGGATTATTACATTC
TTGGAAATAAATTTTCTTAGTATGCTTAGTCTGGTATTTTGTAATCATGGAATGAAAATT
TCCTTAAGGAGTTTTTCTGCTACTTGATTGTTGTTGGATTCTTTATAACTTTTATTCCTT
ATATTTTTAATCCTCGCAAAATATTGGAAATGATTATTTCGTTCATTCATTTCATAGCTT
ACCAGGCATAGTACATACATCTTTTCACAATTTATGCATACTGTAGAATCGATGACTTTT
CATGGGGTACCAAGGGTCAAAGTAATTAATTTGTTTATTTCTAACTTTCTCAATAGAAAT
TTATTTACTTTTTATAAAAAGACACGGCCTCATAATAGTAAGATGTAAGCAAAAGTATTA
AATTTAAGTTTGTATTATAGTGGTTTTTGACAAACTTCTTTATTGCATTTTTGTTTTCTT
CATTTTTAACCTCAACAATCATGCCTGATGAAATGCAGGAATATGTAAAGCCAGCTATTT
TGACAAGTATTTCTGTTGTTTTTGTTGGTTAGCTTGTTTTGAGAGTAATTGGAGCTTTGT
TTTATGAACTTTACTTCATTTACTTCAGAAGAAAAATGGCAAGTAAATAAGATGCCATCC
ACCACTTAAGAGAATAAGGAAGTGAAAAAGAATTACTTAAAAAAATCAATGAAATTAAGC
AAACAATTTAGAGATCTTAAGCTCAAGTTGTTGAAGACAGTATATTATAACCTATTGATA
ATTAATAAATGACTTAGTATGATAACTAACAATCACATTTAGTTTAACAATTCACTTAGT
TTGGCTAATAAAATACTCAAAATGGCTAATAAAACACTATATATGCTTAATGA