Identifiers and Description

Gene Model Identifier

TTHERM_00442110

Standard Name

CHS11 (CHitin Synthase)

Aliases

PreTt05611 | 50.m00180 | 3681.m00039

Description

Chitin synthase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00036 ) EF hand
  • ( PF07813 ) LTXXQ motif
  • ( PF01644 ) Chitin synthase
  • ( PF03142 ) Chitin synthase
  • ( PF06476 ) Protein of unknown function (DUF1090)
  • ( PF07246 ) Phlebovirus nonstructural protein NS-M
  • ( TIGR00341 ) conserved hypothetical protein TIGR00341

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00442110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12548.19.997093137033517e-262chitin synthase (1329 aa)
OxytrichaContig20733.0.g183.000555717977434e-27Chitin synthase
SGDYBR038W2.0009605191578312e-25CHS2 Chitin synthase II; catal
yzes transfer of N-acetylgluco
samine (GlcNAc) to chitin upon
activation of zymogenic form;
required for chitin synthesis
in the primary septum during
cytokinesis; localization regu
lated by Cdk1p during mitosis
Stentor CoeruleusSteCoe_100730.000000000000012664165549094176
WormBaseWBGene000004970.000000000800327577657144locus:chs-2 status:Confirmed
UniProt:G5EBQ8 protein_id
:CCD71483.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00442110(coding)
ATGTCACACAACAACATTTGTGATAAACTCTTATAAGATTATGATAGCGATGATAACGAA
GATGTGAACTTAAATCAATTAGAATAAGACTATAAGTCTGTTTTTTAAGTGAGTGCAAAG
CAATTTCATAATATCCCTAGTACAGATAATTATAATGTTGATAAAAATGTGATTTAAATA
TCTGACAATAACGTTTAATCCAATAACTAGCAGAATCAATTTAATGAAAAATAATAACCA
TCTAATCCTACCAATAATTAGTAGAGGCATATCTAACACCAAAGTAGCTATTAAGGTTAA
TCCTTGCCTTCAATTTTAAAAAAGAAATCCTCCTACGATTAAAGCTCAAATTTAATTTAA
GGCTAATTTGGTTTTGAAGCCTAAAATTTATAAAAAAGTTAAGGAGAGTAGCTGGTAGGT
TCTCGCGATAACAGAGATTCCTAAGACATTGAAAAATCGTAATAATCACCTCTAAATTAG
CAAGTAAGGTTTGGAAGAAAACAAGAAAAAAAGTTTAGTATTTAAGACGAAGTTCTTAAA
CTCGATAGAGTAGAGAGCATCAATCAGTAAAATTAAAAAATTGAAGAAGAGGATTAAAAG
ATTTAAGATTAAGACGAACCAGGAAGCGTAGACTAAGAAATGTTGAACAGATCAGAAATG
GATTACTGGAAAGGTGAACTTCCTTTGGATTTGTTTTTAGAGAGCACCTATGAAAATGGG
TAGAGAACAAATTTAGATGCACTTACTGTTTATAGACCAGATGTAGAACCAATACTTTAT
CAGTCTAAAACAAAAAATATTGAATCTTATTTGTATTTTGATGAGAAATCATATGATTAT
CAAGCAAGTGTAAAAGATGGAAGGAGAAGAAATATGCTTAGAAGAATCAATGAAAATGAC
GGATTTTTAGGTTTCTACAGTCAAAATAAGCGCAGTGATGTCCTTAAGATGCTTATTTGC
GTTACTATGTACAGTGAAAGCAGAGAATTCTTGGAAAATACTCTCTACCATATTTATTAA
AATTAAAAAGGGTTTCTTCAAATTGGGTTAAAAGATTTTCAAATTTGCGTTGTTGTTATA
TAAGATGGTATTATGAAAATGAAAGAAGAGTCAGTTGATTTTTATACTGAAATAGAAGGT
GAAATTAGAGATCCTAAAAGAAACTTAAAAATTAGAAGATTTGACATTTAGAGCCAATTA
GACTACTTTAAGTTTAATAATTAATAATCCCTTATTGATGCTAATGAAGGACTTCCTCCA
ACTATCCCTAAGCGTATTGCTCTTACATACTAAAATCGTTTATATTTTGTAAAGGAAAAT
CATAAAAACAGATACGAAAAACCTAAGGTTTATAGCTCAAATTGCAGAGGCTACTCAAAT
AATTAAATAGGTATGACAGTTTTTAGCGTTTTCAAGCATAAAAATGCAAAAAAGCTCTCC
TCCCACATGTGGTTTTTCGAAGGTTTCTGCAGATAATTTAATCCTAAATACTGCGCTCTT
GTTGATGTAGGAACTTTACCTGCTCCAGACGGATTACTGAAATTTTACATGGCAATGGAA
GGAAATTCAAGGATTGGTGGTGTATGTGGATTCTTAGGTTTAGAAGATCCTCCAGAATAT
AAAAGCAAAGAAAATTAAGTTGTTGAAGGAAATGTATCACTTGATGAAGAAATTAAACAA
AAAAAAGAAAATTTAAGGTTGAATACAAAATGGTGGAATATTTGGCAATCAAAAAAATAA
TAATAGTCTTCTAATCAGAATAACGATAATATTGATGAAGTTTAATAATAAGACATCTAA
AAAATCGAACTTTAAAAGAAAAAAGATTCTCACTTTAAGAAAAAAATAATATCAACTACC
ATTTTTTCATTTTTTTTCTTTCTTCCTATTTAGATAATTTACTTTACTCTTTACTTAATA
TACTTCATCCTCTTTAAATGTGTCTTCAAATGCATTTTCAAAATTCTAAAATGGATTTCA
TATAATTACTTATCTGGATTGGCAAGTCTTAAAAAAGCCCAGCTTTATGAGTACACTATG
GCTCATATGCTAGATAAAAATTTTGAATCACTTTTAGGATTTTTGCATGTTCTTCCAGGT
GCCTGGTCAGCTTATCGATATAAAGCACTAGAAATTAAACTTTCTTAAAGATAAAATCTA
CTATAAAAACGCTATTTTAAATAATTGATAAATCCTGATTAATTAGAAGGAAATATCTAG
GAAGCAAATATGTTTCTAGCAGAAGACAGAATCTTATGTCTTGGTATATATTGCTAGCCA
GATTCTAATTTTATCTTGAAATACATACCTGATGCCTAAGCCTTTACAGATCCTGTTGAA
ACTCTAGAAGAATTTATGAATTAACGTAGAAGATGGATTAACAGTACTCTCTATGCATTA
GATTACGTTTTAAAGCACTTTTCATTTCATGTCCAAGAAAGCAGTCATAGTAGTTTTTCT
AAATATATTCTTTTACCATTTAACATGTTATTTGCAAAAATTGGAAAATTAAACACTTAC
TTTATTCCTGCATTTTACATGTTTGTTGCAATAACAAGCAGCTTTTAATTAATATCGCCT
GAGATAAAAAAAGGCTATATGTTTCGTACAACAGAAAACTACAGTGACGATGATGGATGT
ATTATTGGTATGGAAGAACCACAACAAGATGATCTTTGTTCTTCATAAAATAAGGAATTT
TGCTACATTGTGTGTGAGGAAAAAGACTTTCCCAGTTATCTACTTCTTCTTTTCGATATA
GTACCTGCGATTTACATCATATGCTTCCTGCTGATAGTATTTGCAAGCTTAACTTTTCGT
ATTAAGCGTGTAAACAGACTAGCTGTATTTGAAGAGTTAAGTAGAACATTACTCACAAGT
GAGTAGAAATAAGAAGTTTAAAAAAAAGAAGATGAGATTAAGTAGTAGCAAAAGGTATTG
AGAGAGTCATTGCAACTTTCTTCAAAACAAATTAAGTAAGCAAATAAAAAAATAAATGAA
GCTGAAAAGAAGCTCAAAGAATACATAATAAAGATTACTAAAAAGTCGTTTAAAGAAATG
GAATAAAAGATCTAGTAACACTAAGTGAAGCTTACTCCTAAAGAAAAACTATTTAAAGAA
AAATATGATACATTAACTTCATAAGATTTTTCTAATAGTTCATTTAAAATTCTCTCAGCT
ATTATGTCATTTATAAGTATTATAGTGATGATCATAGTAACTTTTGCCATTTTGATGAAT
ATCTTCAACGATAATTTTGGATTAGTTAAAAGCTTTGTAAAATTAGAATATTGGTTAAGG
TTGTATGTTATCATTATGGCATGTCTCAATACTGGATCATTTTTTATCCTTCTGTTTGTC
CACTTACTTTTCTAACCTAAACTTGTTTGGTATATTATAATATCTTATTGGAGCTATACA
ATATACTAACCTATATATAATTTCACTTTAATCATATTCTCATTTTGTAATATTGATGAT
GTTACTTGGGGAACTAAAGGTATTTCATCAGAAGCTACTTCATAATTGTTTTATCAAAGC
AAAGTTAAATTTCTACTAAAATGGTTTTCAGCAAATGCTCTTCTCTTAATGGTTATGATT
TGTGGTAATATTTTCTCTGGAAAAACTCCTTATATTATTTTGTTAATTGGTATGTATGGA
ACATTGTATCTAACTGTTAAAACTATATTAGCAATATTCAATTACATAAAGTATTTCGTG
ATTGATAAGTGGATAGCATATTGCAGGATCAGAAGATTTAAGAATAAAAATAAAGTGCAA
TAGCAAGAAATAGAAAATAAATTCAAAGATTTCCTAAAGAAGATAGAGTCCTCGAAGACA
AAGAGTCATAATGAATGGAGAGAACTATACAATAATAATAAAACAATCAGCTAAGATTAT
ATTTAGAAGTTTATAACTTCCCCAAAAAGTCATTCATGA


>TTHERM_00442110(protein)
MSHNNICDKLLQDYDSDDNEDVNLNQLEQDYKSVFQVSAKQFHNIPSTDNYNVDKNVIQI
SDNNVQSNNQQNQFNEKQQPSNPTNNQQRHIQHQSSYQGQSLPSILKKKSSYDQSSNLIQ
GQFGFEAQNLQKSQGEQLVGSRDNRDSQDIEKSQQSPLNQQVRFGRKQEKKFSIQDEVLK
LDRVESINQQNQKIEEEDQKIQDQDEPGSVDQEMLNRSEMDYWKGELPLDLFLESTYENG
QRTNLDALTVYRPDVEPILYQSKTKNIESYLYFDEKSYDYQASVKDGRRRNMLRRINEND
GFLGFYSQNKRSDVLKMLICVTMYSESREFLENTLYHIYQNQKGFLQIGLKDFQICVVVI
QDGIMKMKEESVDFYTEIEGEIRDPKRNLKIRRFDIQSQLDYFKFNNQQSLIDANEGLPP
TIPKRIALTYQNRLYFVKENHKNRYEKPKVYSSNCRGYSNNQIGMTVFSVFKHKNAKKLS
SHMWFFEGFCRQFNPKYCALVDVGTLPAPDGLLKFYMAMEGNSRIGGVCGFLGLEDPPEY
KSKENQVVEGNVSLDEEIKQKKENLRLNTKWWNIWQSKKQQQSSNQNNDNIDEVQQQDIQ
KIELQKKKDSHFKKKIISTTIFSFFFFLPIQIIYFTLYLIYFILFKCVFKCIFKILKWIS
YNYLSGLASLKKAQLYEYTMAHMLDKNFESLLGFLHVLPGAWSAYRYKALEIKLSQRQNL
LQKRYFKQLINPDQLEGNIQEANMFLAEDRILCLGIYCQPDSNFILKYIPDAQAFTDPVE
TLEEFMNQRRRWINSTLYALDYVLKHFSFHVQESSHSSFSKYILLPFNMLFAKIGKLNTY
FIPAFYMFVAITSSFQLISPEIKKGYMFRTTENYSDDDGCIIGMEEPQQDDLCSSQNKEF
CYIVCEEKDFPSYLLLLFDIVPAIYIICFLLIVFASLTFRIKRVNRLAVFEELSRTLLTS
EQKQEVQKKEDEIKQQQKVLRESLQLSSKQIKQANKKINEAEKKLKEYIIKITKKSFKEM
EQKIQQHQVKLTPKEKLFKEKYDTLTSQDFSNSSFKILSAIMSFISIIVMIIVTFAILMN
IFNDNFGLVKSFVKLEYWLRLYVIIMACLNTGSFFILLFVHLLFQPKLVWYIIISYWSYT
IYQPIYNFTLIIFSFCNIDDVTWGTKGISSEATSQLFYQSKVKFLLKWFSANALLLMVMI
CGNIFSGKTPYIILLIGMYGTLYLTVKTILAIFNYIKYFVIDKWIAYCRIRRFKNKNKVQ
QQEIENKFKDFLKKIESSKTKSHNEWRELYNNNKTISQDYIQKFITSPKSHS


>TTHERM_00442110(gene)
ATGTCACACAACAACATTTGTGATAAACTCTTATAAGATTATGATAGCGATGATAACGAA
GATGTGAACTTAAATCAATTAGAATAAGACTATAAGTCTGTTTTTTAAGTGAGTGCAAAG
CAATTTCATAATATCCCTAGTACAGATAATTATAATGTTGATAAAAATGTGATTTAAATA
TCTGACAATAACGTTTAATCCAATAACTAGCAGAATCAATTTAATGAAAAATAATAACCA
TCTAATCCTACCAATAATTAGTAGAGGCATATCTAACACCAAAGTAGCTATTAAGGTTAA
TCCTTGCCTTCAATTTTAAAAAAGAAATCCTCCTACGATTAAAGCTCAAATTTAATTTAA
GGCTAATTTGGTTTTGAAGCCTAAAATTTATAAAAAAGTTAAGGAGAGTAGCTGGTAGGT
TCTCGCGATAACAGAGATTCCTAAGACATTGAAAAATCGTAATAATCACCTCTAAATTAG
CAAGTAAGGTTTGGAAGAAAACAAGAAAAAAAGTTTAGTATTTAAGACGAAGTTCTTAAA
CTCGATAGAGTAGAGAGCATCAATCAGTAAAATTAAAAAATTGAAGAAGAGGATTAAAAG
ATTTAAGATTAAGACGAACCAGGAAGCGTAGACTAAGAAATGTTGAACAGATCAGAAATG
GATTACTGGAAAGGTGAACTTCCTTTGGATTTGTTTTTAGAGAGCACCTATGAAAATGGG
TAGAGAACAAATTTAGATGCACTTACTGTTTATAGACCAGATGTAGAACCAATACTTTAT
CAGTCTAAAACAAAAAATATTGAATCTTATTTGTATTTTGATGAGAAATCATATGATTAT
CAAGCAAGTGTAAAAGATGGAAGGAGAAGAAATATGCTTAGAAGAATCAATGAAAATGAC
GGATTTTTAGGTTTCTACAGTCAAAATAAGCGCAGTGATGTCCTTAAGATGCTTATTTGC
GTTACTATGTACAGTGAAAGCAGAGAATTCTTGGAAAATACTCTCTACCATATTTATTAA
AATTAAAAAGGGTTTCTTCAAATTGGGTTAAAAGATTTTCAAATTTGCGTTGTTGTTATA
TAAGATGGTATTATGAAAATGAAAGAAGAGTCAGTTGATTTTTATACTGAAATAGAAGGT
GAAATTAGAGATCCTAAAAGAAACTTAAAAATTAGAAGATTTGACATTTAGAGCCAATTA
GACTACTTTAAGTTTAATAATTAATAATCCCTTATTGATGCTAATGAAGGACTTCCTCCA
ACTATCCCTAAGCGTATTGCTCTTACATACTAAAATCGTTTATATTTTGTAAAGGAAAAT
CATAAAAACAGATACGAAAAACCTAAGGTTTATAGCTCAAATTGCAGAGGCTACTCAAAT
AATTAAATAGGTATGACAGTTTTTAGCGTTTTCAAGCATAAAAATGCAAAAAAGCTCTCC
TCCCACATGTGGTTTTTCGAAGGTTTCTGCAGATAATTTAATCCTAAATACTGCGCTCTT
GTTGATGTAGGAACTTTACCTGCTCCAGACGGATTACTGAAATTTTACATGGCAATGGAA
GGAAATTCAAGGATTGGTGGTGTATGTGGATTCTTAGGTTTAGAAGATCCTCCAGAATAT
AAAAGCAAAGAAAATTAAGTTGTTGAAGGAAATGTATCACTTGATGAAGAAATTAAACAA
AAAAAAGAAAATTTAAGGTTGAATACAAAATGGTGGAATATTTGGCAATCAAAAAAATAA
TAATAGTCTTCTAATCAGAATAACGATAATATTGATGAAGTTTAATAATAAGACATCTAA
AAAATCGAACTTTAAAAGAAAAAAGATTCTCACTTTAAGAAAAAAATAATATCAACTACC
ATTTTTTCATTTTTTTTCTTTCTTCCTATTTAGATAATTTACTTTACTCTTTACTTAATA
TACTTCATCCTCTTTAAATGTGTCTTCAAATGCATTTTCAAAATTCTAAAATGGATTTCA
TATAATTACTTATCTGGATTGGCAAGTCTTAAAAAAGCCCAGCTTTATGAGTACACTATG
GCTCATATGCTAGATAAAAATTTTGAATCACTTTTAGGATTTTTGCATGTTCTTCCAGGT
GCCTGGTCAGCTTATCGATATAAAGCACTAGAAATTAAACTTTCTTAAAGATAAAATCTA
CTATAAAAACGCTATTTTAAATAATTGATAAATCCTGATTAATTAGAAGGAAATATCTAG
GAAGCAAATATGTTTCTAGCAGAAGACAGAATCTTATGTCTTGGTATATATTGCTAGCCA
GATTCTAATTTTATCTTGAAATACATACCTGATGCCTAAGCCTTTACAGATCCTGTTGAA
ACTCTAGAAGAATTTATGAATTAACGTAGAAGATGGATTAACAGTACTCTCTATGCATTA
GATTACGTTTTAAAGCACTTTTCATTTCATGTCCAAGAAAGCAGTCATAGTAGTTTTTCT
AAATATATTCTTTTACCATTTAACATGTTATTTGCAAAAATTGGAAAATTAAACACTTAC
TTTATTCCTGCATTTTACATGTTTGTTGCAATAACAAGCAGCTTTTAATTAATATCGCCT
GAGATAAAAAAAGGCTATATGTTTCGTACAACAGAAAACTACAGTGACGATGATGGATGT
ATTATTGGTATGGAAGAACCACAACAAGATGATCTTTGTTCTTCATAAAATAAGGAATTT
TGCTACATTGTGTGTGAGGAAAAAGACTTTCCCAGTTATCTACTTCTTCTTTTCGATATA
GTACCTGCGATTTACATCATATGCTTCCTGCTGATAGTATTTGCAAGCTTAACTTTTCGT
ATTAAGCGTGTAAACAGACTAGCTGTATTTGAAGAGTTAAGTAGAACATTACTCACAAGT
GAGTAGAAATAAGAAGTTTAAAAAAAAGAAGATGAGATTAAGTAGTAGCAAAAGGTATTG
AGAGAGTCATTGCAACTTTCTTCAAAACAAATTAAGTAAGCAAATAAAAAAATAAATGAA
GCTGAAAAGAAGCTCAAAGAATACATAATAAAGATTACTAAAAAGTCGTTTAAAGAAATG
GAATAAAAGATCTAGTAACACTAAGTGAAGCTTACTCCTAAAGAAAAACTATTTAAAGAA
AAATATGATACATTAACTTCATAAGATTTTTCTAATAGTTCATTTAAAATTCTCTCAGCT
ATTATGTCATTTATAAGTATTATAGTGATGATCATAGTAACTTTTGCCATTTTGATGAAT
ATCTTCAACGATAATTTTGGATTAGTTAAAAGCTTTGTAAAATTAGAATATTGGTTAAGG
TTGTATGTTATCATTATGGCATGTCTCAATACTGGATCATTTTTTATCCTTCTGTTTGTC
CACTTACTTTTCTAACCTAAACTTGTTTGGTATATTATAATATCTTATTGGAGCTATACA
ATATACTAACCTATATATAATTTCACTTTAATCATATTCTCATTTTGTAATATTGATGAT
GTTACTTGGGGAACTAAAGGTATTTCATCAGAAGCTACTTCATAATTGTTTTATCAAAGC
AAAGTTAAATTTCTACTAAAATGGTTTTCAGCAAATGCTCTTCTCTTAATGGTTATGATT
TGTGGTAATATTTTCTCTGGAAAAACTCCTTATATTATTTTGTTAATTGGTATGTATGGA
ACATTGTATCTAACTGTTAAAACTATATTAGCAATATTCAATTACATAAAGTATTTCGTG
ATTGATAAGTGGATAGCATATTGCAGGATCAGAAGATTTAAGAATAAAAATAAAGTGCAA
TAGCAAGAAATAGAAAATAAATTCAAAGATTTCCTAAAGAAGATAGAGTCCTCGAAGACA
AAGAGTCATAATGAATGGAGAGAACTATACAATAATAATAAAACAATCAGCTAAGATTAT
ATTTAGAAGTTTATAACTTCCCCAAAAAGTCATTCATGA